| Basic Information | |
|---|---|
| Family ID | F095923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPHGKKFVFHRVEKRIPMEIPVLIDGHRRAPGSESTFTENVSAR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.46 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.78% Coil/Unstructured: 72.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 92.38 |
| PF09360 | zf-CDGSH | 2.86 |
| PF00581 | Rhodanese | 1.90 |
| PF14464 | Prok-JAB | 0.95 |
| PF02597 | ThiS | 0.95 |
| PF00899 | ThiF | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.95 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.10 % |
| Unclassified | root | N/A | 1.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_105703178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300005440|Ga0070705_100185683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
| 3300005471|Ga0070698_101443359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005553|Ga0066695_10869601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005555|Ga0066692_10811254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300005555|Ga0066692_10995677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005586|Ga0066691_10545816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300005591|Ga0070761_10021405 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300005591|Ga0070761_10750519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300006032|Ga0066696_10585714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006173|Ga0070716_101126024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300006173|Ga0070716_101341780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300006903|Ga0075426_10031320 | All Organisms → cellular organisms → Bacteria | 3804 | Open in IMG/M |
| 3300006914|Ga0075436_101073722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300007788|Ga0099795_10280766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300009088|Ga0099830_10495946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300009088|Ga0099830_10803414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300009089|Ga0099828_11558565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009090|Ga0099827_10156763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1866 | Open in IMG/M |
| 3300010321|Ga0134067_10190113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300010325|Ga0134064_10090423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300010343|Ga0074044_11092906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010359|Ga0126376_10394468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300010360|Ga0126372_10021358 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
| 3300010360|Ga0126372_10298345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300010361|Ga0126378_10189311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2128 | Open in IMG/M |
| 3300010379|Ga0136449_101065658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300011269|Ga0137392_11067478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300011270|Ga0137391_10491928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300012096|Ga0137389_10889071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300012189|Ga0137388_10101767 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300012206|Ga0137380_11321065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012210|Ga0137378_11637523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012349|Ga0137387_10219813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
| 3300012359|Ga0137385_11425795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012683|Ga0137398_10031642 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
| 3300012683|Ga0137398_10294250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300012918|Ga0137396_10366071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300012918|Ga0137396_10732459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300012924|Ga0137413_10508528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300012927|Ga0137416_10260988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300014165|Ga0181523_10212037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300015054|Ga0137420_1145592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300015054|Ga0137420_1221166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300015245|Ga0137409_10061093 | All Organisms → cellular organisms → Bacteria | 3546 | Open in IMG/M |
| 3300015356|Ga0134073_10046474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300015356|Ga0134073_10321605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300016422|Ga0182039_10960916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300017942|Ga0187808_10518630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300017972|Ga0187781_10937344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300017972|Ga0187781_11014984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300017974|Ga0187777_10201292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300018034|Ga0187863_10444961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300018086|Ga0187769_11537384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300019788|Ga0182028_1392912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1940 | Open in IMG/M |
| 3300020170|Ga0179594_10173712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300020580|Ga0210403_10121182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2128 | Open in IMG/M |
| 3300020582|Ga0210395_11010437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300021168|Ga0210406_10836363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300021168|Ga0210406_10935691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300021168|Ga0210406_11212834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021170|Ga0210400_11496264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021171|Ga0210405_10335561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300021171|Ga0210405_11083608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300021180|Ga0210396_10179729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1894 | Open in IMG/M |
| 3300021180|Ga0210396_11430717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300021432|Ga0210384_10733501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300021432|Ga0210384_11752663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021478|Ga0210402_10651103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300022533|Ga0242662_10078143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300024330|Ga0137417_1221628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300024330|Ga0137417_1286414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300026313|Ga0209761_1010634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5988 | Open in IMG/M |
| 3300026330|Ga0209473_1191552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300026469|Ga0257169_1021400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300026482|Ga0257172_1045388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300026508|Ga0257161_1113853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300026548|Ga0209161_10452225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027512|Ga0209179_1080077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300027651|Ga0209217_1113367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300027663|Ga0208990_1032682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300027669|Ga0208981_1159933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027671|Ga0209588_1063569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300027698|Ga0209446_1031981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300027703|Ga0207862_1091432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300027817|Ga0209112_10134649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300027842|Ga0209580_10030642 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300027862|Ga0209701_10049831 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300028775|Ga0302231_10464541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031546|Ga0318538_10659542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031718|Ga0307474_11502883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300031753|Ga0307477_10254868 | Not Available | 1215 | Open in IMG/M |
| 3300031754|Ga0307475_10920244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300031835|Ga0318517_10505936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031879|Ga0306919_10741895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300031962|Ga0307479_10489075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300032067|Ga0318524_10214119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300032174|Ga0307470_10112787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
| 3300032261|Ga0306920_103903916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300032782|Ga0335082_10170779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2088 | Open in IMG/M |
| 3300032783|Ga0335079_10183444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2331 | Open in IMG/M |
| 3300032805|Ga0335078_10670834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300032893|Ga0335069_12681496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300032955|Ga0335076_10388451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.95% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1057031781 | 3300005332 | Tropical Forest Soil | MPLTTKFTFHRAEKRILMEIPVLIDGHRDAPGLEPTFTENVSARGARVIS |
| Ga0070705_1001856831 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHKGTFSFHRVERRIPMEIPVVLDGHRNTPGSESTFTEN |
| Ga0070698_1014433591 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MALKTTLTFFRAEKRVPMEIPVVLDGHRRTPGTESTFTENVSARGA |
| Ga0066695_108696012 | 3300005553 | Soil | MPDAKRFAFHRAESRIPMEIPVLIDGHREAPGSESTFTENVSARG |
| Ga0066692_108112541 | 3300005555 | Soil | MAMPHGKKFSFHRVEKRIPMEIPVSIDGHRQAPGSES |
| Ga0066692_109956771 | 3300005555 | Soil | MAHRKRFVLNRTERRILMEIPVLIEGHGRAPGSESTFTEN |
| Ga0066691_105458162 | 3300005586 | Soil | MAMPHGKKFSFHRVEKRIPMEIPVSIDGHRQAPGSE |
| Ga0070761_100214055 | 3300005591 | Soil | MPLKTAFTFHRVERRIPMEIPVVLDGHSATPGAES |
| Ga0070761_107505192 | 3300005591 | Soil | MFHRVERRIPMEIPVLLDGHRRMPGTESTFTENVSAR |
| Ga0066696_105857141 | 3300006032 | Soil | MPHAKRFAFHRAESRIPMEIPVLIDGHREAPGSESTFTENVSA |
| Ga0070716_1011260242 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHKPLKTIFRFHRGESRIPMEIPVVLDGHQGTSGAESTFTENVSARGARV |
| Ga0070716_1013417801 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLKATFTYHRTERRIPMEIPVVLDGHRLTPGAES |
| Ga0075426_100313205 | 3300006903 | Populus Rhizosphere | MPLTTKFTFHRMEKRILMEIPVLIDGHRDAPGLESTFTENVSARGARVISV |
| Ga0075436_1010737221 | 3300006914 | Populus Rhizosphere | MPLTTKFTFHRAEKRILMEIPVLIDGHRDAPGMESTF |
| Ga0099795_102807661 | 3300007788 | Vadose Zone Soil | MSKTMPQGKKFSFHRAERRIPMEIPVLIDGHRQAPGLE |
| Ga0099830_104959461 | 3300009088 | Vadose Zone Soil | MPPRNIHPFNRRENRIPMEIPVVLDGHRHLPGMEATFT |
| Ga0099830_108034142 | 3300009088 | Vadose Zone Soil | MPPKPTYTFFRAEKSIPMEIPVVLGGHRRAPGRESTFTHNV |
| Ga0099828_115585651 | 3300009089 | Vadose Zone Soil | MPPKTTYTFFRAEKRIPMEIPVVLDGHRRTPGRESTFTENVS |
| Ga0099827_101567631 | 3300009090 | Vadose Zone Soil | MDMTMPHGKKFSFHRVEKRIPMEIPVSIDGHRQAPGSESTFTENV |
| Ga0134067_101901131 | 3300010321 | Grasslands Soil | MPLRSKFVFHRVEQRILMEIPVLIDGHRDVPGSETTFTQDVSARGARV |
| Ga0134064_100904231 | 3300010325 | Grasslands Soil | MPLRSKFVFHRVEQRILMEIPVLIDGHRDVPGAETTFTQDVSARGARVISARY* |
| Ga0074044_110929061 | 3300010343 | Bog Forest Soil | MQPLRRREDRIPMEIPVVLRGHRQVPGTESTFTENVS |
| Ga0126376_103944681 | 3300010359 | Tropical Forest Soil | MPLKSKFVFHRTEERILMEIPVLIDGHRDVPGRESTFTQNVSARGARVIS |
| Ga0126372_100213581 | 3300010360 | Tropical Forest Soil | MPPHKNKFTFPRSENRIPMEIPVMLEGHRHLPGVETTF |
| Ga0126372_102983452 | 3300010360 | Tropical Forest Soil | MPLKTKFVFHRTEERILMEIPVLIDGHRDVPGRESTFT |
| Ga0126378_101893112 | 3300010361 | Tropical Forest Soil | MPLTTKFTFHRAEKRILMEIPVLIDGHRDAPGTES |
| Ga0136449_1010656581 | 3300010379 | Peatlands Soil | MFHRAENRIPMEIPVLIDGHRKVPGSESTFTENVSA |
| Ga0137392_110674781 | 3300011269 | Vadose Zone Soil | MPPWKTFVFYRADKRIPMEIPVVLDGHRQTPGTESTFTENVSAH |
| Ga0137391_104919282 | 3300011270 | Vadose Zone Soil | MLHKKKFASHRAERRIPMEIPVLIDGHRQAPGSESTFTENVSA |
| Ga0137389_108890712 | 3300012096 | Vadose Zone Soil | MPPKTTYTFFRAEKRIPMEIPVVLDGHRRTPGRESTFTE |
| Ga0137388_101017671 | 3300012189 | Vadose Zone Soil | MTKDMPHLKKFGFHRAEKRIPMEIPVVLDGHRQLPGTESTFTENVSA |
| Ga0137380_113210651 | 3300012206 | Vadose Zone Soil | MDMTMPHGKKFSFHRVEKRIPMEIPVSIDGHRQAPGSEPTFTENVSVH |
| Ga0137378_116375231 | 3300012210 | Vadose Zone Soil | MIMPHGKKFSFHRVEKRIPMEIAVSIDGHRQAPGSESTFTEN |
| Ga0137387_102198132 | 3300012349 | Vadose Zone Soil | MLLKTKVVCHRAEKRILMEIPVVIDGHRDAPGSESTFTE |
| Ga0137385_114257951 | 3300012359 | Vadose Zone Soil | MPHAKKFIFHRVEQRIPMEIPVLIDGHRDAPGSESNFT |
| Ga0137398_100316424 | 3300012683 | Vadose Zone Soil | MIKKMPHKLKFSFHRVEKRIPMEIPVLIDGHRQAPGSESTFTENVSARGA |
| Ga0137398_102942501 | 3300012683 | Vadose Zone Soil | MPLKTTFTFFRAEKRVPMEIPVVLDGHRRTPGTESTFTEN |
| Ga0137396_103660712 | 3300012918 | Vadose Zone Soil | MATMPPRKRFSFQRAENRILMEIPVFIDGHRQVPGSE |
| Ga0137396_107324591 | 3300012918 | Vadose Zone Soil | VSVDKQMPHAKKFMSNRTEKRIPMEIPVLIDGHRRAPGSES |
| Ga0137413_105085281 | 3300012924 | Vadose Zone Soil | MPPRNIHPFNRRENRIPMEIPVVLDGHRHLPGLEA |
| Ga0137416_102609881 | 3300012927 | Vadose Zone Soil | MPPRNIRPFLRRENRIPMEIPVVLDGHRHLPGTEATFTENVSAKGA |
| Ga0181523_102120371 | 3300014165 | Bog | MDHRSQFRFNRSENRIPMEIPVVLEGHRQIPGVEATFTENVS |
| Ga0137420_11455921 | 3300015054 | Vadose Zone Soil | MPPRKRFSFHRAEHRILMEIPVFIDGHRQVPGSESTFTEHVSA |
| Ga0137420_12211661 | 3300015054 | Vadose Zone Soil | MRMSKTMPQGKKFSFHRAERRILMEIPVLIDGHRQAPGSESTFTENVSA |
| Ga0137409_100610931 | 3300015245 | Vadose Zone Soil | MPLRNKFTFHRAENRILMEIPVFIDGHRQVPGSESTF |
| Ga0134073_100464742 | 3300015356 | Grasslands Soil | MPHAKRFAFHRAESRIPMEIPVLIDGHREAPGSESTFTEN |
| Ga0134073_103216052 | 3300015356 | Grasslands Soil | MPLRSKFVFHRVEQRILMEIPELIDGHRDVPGSETTFTQDVSARGARVIS |
| Ga0182039_109609162 | 3300016422 | Soil | MPLKTKFVFHRTEERILMEIPVLIDGHRDVPGRESTFTENVSARGARVI |
| Ga0187808_105186302 | 3300017942 | Freshwater Sediment | MPLRRHFTFHRAEKRIPMEIPVLIDGHRQAPGSESTFTENVSPGGARVVTV |
| Ga0187781_109373442 | 3300017972 | Tropical Peatland | MPLRSHFTFHRADKRIPMEIPVMIDGHRQAPGSESTFTENV |
| Ga0187781_110149842 | 3300017972 | Tropical Peatland | MPDRNPYPLRRERRIPMEIPVVLDGHRQLPGAEHTFTENVSPRGA |
| Ga0187777_102012922 | 3300017974 | Tropical Peatland | MDRQNQFRFNRRENRIPMEIPVVLDGHRKVPGVEATFTENVSSKGA |
| Ga0187804_101623822 | 3300018006 | Freshwater Sediment | MTSSNDFRFHRSESRIPMEIPVVLEGSRQFPGVEA |
| Ga0187863_104449611 | 3300018034 | Peatland | MPLKTVFTFHRAERRIPMEIPVVLDGHRATPGAESTFTENV |
| Ga0187769_115373841 | 3300018086 | Tropical Peatland | MPLRTKFAFHRAEKRVPMEIPVVIDGHRQAPGSESTFTENVSVHGARVVTV |
| Ga0182028_13929121 | 3300019788 | Fen | MAHGHIHPHPRRETRIQMEIPVVLEGHRQLPGTEATFTENVSAKGARV |
| Ga0179594_101737121 | 3300020170 | Vadose Zone Soil | MPLRNKFTFHRAENRILMEIPVFIDGHRQVPGSESTFTENVSAR |
| Ga0210403_101211821 | 3300020580 | Soil | MSSRNIHPFNRRENRIPMEIPVVLDGHRQLPGMEATFTENVSAKGARV |
| Ga0210395_110104371 | 3300020582 | Soil | MPLKKLFPFHRNERRILMEIPVVLDRHEGAQGTESTFTENVSARGARVV |
| Ga0210406_108363632 | 3300021168 | Soil | MPPRNGHPFNRRENRIPMEIPVVLDGHRHLPGTEATFTENVSAK |
| Ga0210406_109356912 | 3300021168 | Soil | MMKMSSRSIHPFNRRENRIPMEIPVVLDGHRHLPGMEATFTENVSAKGARVVS |
| Ga0210406_112128341 | 3300021168 | Soil | MPPKTTYTFFRAEKRIPMEIPVVLAGHRRTPGTESTFTENV |
| Ga0210400_114962642 | 3300021170 | Soil | MPASNIHPFNRRENRIPMEIPVVLDGHRHLPGMEATFTENVSAKGA |
| Ga0210405_103355612 | 3300021171 | Soil | MSPRRNFAFHRAERRIPMEIPVVLDGHRQTPGAESTFTENVSA |
| Ga0210405_110836081 | 3300021171 | Soil | MPHAKKTVSHRAERRIPMEIPVLIDGHRRAPGSESTFTE |
| Ga0210396_101797291 | 3300021180 | Soil | MPPRRNFAFHRAERRIPMEIPVVLDGHRQTPGAESTFTENVSA |
| Ga0210396_114307171 | 3300021180 | Soil | MPPRMIHPFNRRENRIPMEIPVVLDGHRHLPGLEA |
| Ga0210384_107335012 | 3300021432 | Soil | MPVRMIKKMPHKLKFSFHRVEKRIPMEIPVLIDGHRQAPGSESTF |
| Ga0210384_117526631 | 3300021432 | Soil | MPSSNVHPFNRRENRIPMEIPVVLDGHRHLPGMEATFAEDVS |
| Ga0210402_106511032 | 3300021478 | Soil | MPRKARFSFHRAEHRILMEIPVLIDGHRQVPGSESTFTENV |
| Ga0242662_100781431 | 3300022533 | Soil | MPPRMIHPFNRRENRIPMEIPVVLDGHRHLPGMEATFTENVSAKGA |
| Ga0137417_12216282 | 3300024330 | Vadose Zone Soil | MPRGKKFVFHRVEKRIPMEIPVLIDGHRRAPGSESTFT |
| Ga0137417_12864141 | 3300024330 | Vadose Zone Soil | MPRGKKFVFHRVEKRIPMEIPVLIDGHRRAPGSEST |
| Ga0209761_10106341 | 3300026313 | Grasslands Soil | MPHAKKFMFHRVEQRIPMEIPVLIDGHRDAPGSESTFTE |
| Ga0209473_11915522 | 3300026330 | Soil | MPDAKRFAFHRAESRIPMEIPVLIDGHREAPGSESTFTENVSAR |
| Ga0257169_10214002 | 3300026469 | Soil | MPLRNKFTFHRAENRILMEIPVFIDGHRQVPGSESTFTENVSARGARV |
| Ga0257172_10453882 | 3300026482 | Soil | MPHGKKFVFHRVEKRIPMEIPVLIDGHRRAPGSESTFTENVSAR |
| Ga0257161_11138532 | 3300026508 | Soil | MPPKTTHTFFRAEKRIPMEIPVVLDGHRRTPGRESTFTEN |
| Ga0209161_104522252 | 3300026548 | Soil | MPHAKKFIFHRVEQRIPMEIPVLIDGHRDAPGSESTFTEN |
| Ga0209179_10800772 | 3300027512 | Vadose Zone Soil | MPHKLKFSFHRVEQRIPMEIPVLIDGHRQAPGSESTFTENVSARGA |
| Ga0209217_11133671 | 3300027651 | Forest Soil | MLPKTTYTFFRADKRIPMEIPVMLDGHRRTPGTESTFTE |
| Ga0208990_10326822 | 3300027663 | Forest Soil | MPHGKKFVFHRVEKRIPMEIPVLIDGHRRAPGSESTFTENVSARG |
| Ga0208981_11599332 | 3300027669 | Forest Soil | MPQGKKFSFHRAERRIPMEIPVLIDGHRQAPGSEPTFTENVSAR |
| Ga0209588_10635691 | 3300027671 | Vadose Zone Soil | VSMNKNMPHAKKTAFHRAERRIPMEIPVLIDGHRRAPGSES |
| Ga0209446_10319812 | 3300027698 | Bog Forest Soil | MATSRNDLAYRRRENRIPMEIPVVLQGHRQGPGSEHTFTENVSA |
| Ga0207862_10914322 | 3300027703 | Tropical Forest Soil | MPPRTNHPFPRRETRIPMEIPVVLEGHRQAPGVEATF |
| Ga0209112_101346491 | 3300027817 | Forest Soil | VRLTTTMPLKKLFPFHRNERRILMEIPVVLDRHQGAQGSESTFTENVSARGARVVSTRRW |
| Ga0209580_100306421 | 3300027842 | Surface Soil | MPLTTKFTFHRAEKRILMEIPVLIDGHREAPGLEST |
| Ga0209701_100498314 | 3300027862 | Vadose Zone Soil | MPHAKKFMSNRTEKRIPMEIPVLIDGHRRAPGSESTFTENV |
| Ga0302231_104645412 | 3300028775 | Palsa | MSKTSTTRFTFQRTEDRIPMEIPVILNGHRATPAAESTFTENVSAR |
| Ga0318538_106595422 | 3300031546 | Soil | MPPRNIHPLQRRENRIPMEIPVVLDGHRHLPGTEATITENVSLNGARVVSMRRWDKDAKL |
| Ga0307474_115028831 | 3300031718 | Hardwood Forest Soil | MPPKATHTFFRAEKRIPMEIPVVLDGHRRTPGTESTFTENV |
| Ga0307477_102548681 | 3300031753 | Hardwood Forest Soil | VRTIDAAMPPKTTYTFFRAEKRIPMEIPVVLAGHRRTPGTEST |
| Ga0307475_109202442 | 3300031754 | Hardwood Forest Soil | MPPRNSRPFLRRENRIPMEIPVVLDGHRHLPGMEATFTENVSAK |
| Ga0318517_105059362 | 3300031835 | Soil | MPLRTKFVFERVEQRILMEIPVLIAGHRDVPGSESTFTQNVSARGARV |
| Ga0306919_107418952 | 3300031879 | Soil | MMPPRNNHAVPRRENRIPMEIPVVLDGHRQVPGVEATFTENVSAKGAR |
| Ga0307479_104890751 | 3300031962 | Hardwood Forest Soil | MPLRTKFSFHRVERRIPMEIPVMIDGHSLAPGSESTF |
| Ga0318524_102141192 | 3300032067 | Soil | MPLRTKFVFERVEQRILMEIPVLIAGHRDVPGSESTFTQN |
| Ga0307470_101127871 | 3300032174 | Hardwood Forest Soil | MPPRNGHPFNRRENRIPMEIPVVLDGHRHLPGMEATFTENVSAKG |
| Ga0306920_1039039161 | 3300032261 | Soil | MPLTTKFAFHRAEKRILMEIPVLIDGHRDAPGTEWTFTENIS |
| Ga0335082_101707791 | 3300032782 | Soil | MPTHRNKFNFPRSENRIPMEIPVMLEGHRHLPGVENTFTENVS |
| Ga0335079_101834441 | 3300032783 | Soil | MPPRTRFSFHRSENRIPMEIPVMLEGHRHLPGVETTFTEN |
| Ga0335078_106708342 | 3300032805 | Soil | MPQKNMFSFHRRENRIPMEIPVVLDGHRHLPGAESTFTENVSARG |
| Ga0335069_126814962 | 3300032893 | Soil | MPHKNKFTFHRTERRIPMEIPLMLEGNRSLPGVETTF |
| Ga0335076_103884511 | 3300032955 | Soil | MPPSNRFSFHRSENRIPMEIPVMLEGHRHLPGVETTFTENV |
| ⦗Top⦘ |