| Basic Information | |
|---|---|
| Family ID | F095918 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VLRARGFDDVLDPLGPKELASLFPYSVRVLNTGMTLIAVGPE |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 95.24 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.476 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (6.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.14% β-sheet: 11.43% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF04932 | Wzy_C | 8.57 |
| PF13425 | O-antigen_lig | 1.90 |
| PF08241 | Methyltransf_11 | 0.95 |
| PF01988 | VIT1 | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF03483 | B3_4 | 0.95 |
| PF01019 | G_glu_transpept | 0.95 |
| PF01915 | Glyco_hydro_3_C | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 8.57 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.95 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.48 % |
| All Organisms | root | All Organisms | 9.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 5.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02828720 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | RARARLIPFDDVLDPLGPKALASLFPYSVRVINRGMTLIAIGPV |
| N55_09838190 | 2189573000 | Grass Soil | DLRRRALHARGFDDVLDSLRPGDFASLFPYPVRIMRRGMTLVAVGPA |
| JGI10216J12902_1056449451 | 3300000956 | Soil | RLLRARGFDDVLDPLGPTELASLFPYPVQVLNRGATLVAVGPV* |
| A1565W1_102805944 | 3300001536 | Permafrost | VGAXXXXLLPFDDVLDPLSAKDLAALFPYRVRVINTGMTLIAIGPE* |
| Ga0062595_1003065161 | 3300004479 | Soil | RAVRARGFDATLDLLGPRELASLFPYSVRVLNRGMTLIAIGPR* |
| Ga0070658_106504872 | 3300005327 | Corn Rhizosphere | VRARGFDDVLDPLGPKALAALFPYSVRVINTGMTLIAIGPE* |
| Ga0070673_1008948461 | 3300005364 | Switchgrass Rhizosphere | RDRVLRARGFDDVLEPLGPSELASLFPYRVRIVNTGMTLIAVGPE* |
| Ga0070714_1008982112 | 3300005435 | Agricultural Soil | RERLFRARGFDDVLEPLGPAELASLFPYPVRILNNGLTLVAVGPE* |
| Ga0066681_102641961 | 3300005451 | Soil | RQRLFRARGFDDVLDPLGPKDLAALFPYPVRVLNRGLTLVAVGPV* |
| Ga0070663_1009284051 | 3300005455 | Corn Rhizosphere | FRARGFDDVLDPLGPRELAALFPYPVRIASRGMTLVAAGPV* |
| Ga0070681_108286431 | 3300005458 | Corn Rhizosphere | VIPFDDVLDPLGPKAFASLFPYEVRVLNRGMTLVAVGPA* |
| Ga0070741_105386902 | 3300005529 | Surface Soil | PFDDVLDPLGPKDLAALFPYSVRVLNRGMTLVAVGPSDELSV* |
| Ga0070679_1002296311 | 3300005530 | Corn Rhizosphere | RVIPFDDVLDPLGPKAFASLFPYEVRVLNRGMTLVAVGPA* |
| Ga0070735_107230681 | 3300005534 | Surface Soil | ERLLRRRGFADVLDPLGPRELAALFPYPVRVINRGLTLVAVGPR* |
| Ga0070730_109938762 | 3300005537 | Surface Soil | DDALDPLGPRELAALFPYPVRLVSRGMTLVAVGPA* |
| Ga0070696_1008553521 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RERLFRARGFDDVLDPLGPGELAALFPYRVRVLNRGLTLIAIGPV* |
| Ga0070664_1023162472 | 3300005564 | Corn Rhizosphere | RVIPFDDVLDLLGPKDLEGLFPYSVRVINTGMTLIAVGPR* |
| Ga0068856_1022091902 | 3300005614 | Corn Rhizosphere | PVAPRTRVLRAAGFDDVLDPLGPRAFASLFPYSVRVLNRGMTLIAIGPA* |
| Ga0066903_1036000401 | 3300005764 | Tropical Forest Soil | LLPFDDVLDPLSGKELAALFPYSVRVINSGMTLIAVGPT* |
| Ga0066903_1057472441 | 3300005764 | Tropical Forest Soil | DRLFRARGFNDVLDPLGPRELAALFPYPVRIASRGMTLVAVGPV* |
| Ga0066903_1072498572 | 3300005764 | Tropical Forest Soil | ARGFDDVLDPLGPRDLAALFPYRVRVLNRGLTLVAVGPE* |
| Ga0066903_1087311992 | 3300005764 | Tropical Forest Soil | PFDDVLDPLGPKAFASLFPYDVRVLNRGMTLIAIGPR* |
| Ga0066696_108251621 | 3300006032 | Soil | AARRRLFRARGFDDVLDPLGPKEFAALFPYPVRVLNRGLTLVAVGPV* |
| Ga0070716_1012731322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IPFDDVLDPLGPKAFASLFPYEVRVLNRGMTLIAVGPA* |
| Ga0066658_109069503 | 3300006794 | Soil | LLRARGFDDVLDPLGPKELASLFPYPVRVLNRGLTLVAVGPA* |
| Ga0066665_116404002 | 3300006796 | Soil | FDDVLDPLGSKELASLFPYSVRVLNRGMTLIAIGPE* |
| Ga0079219_101867502 | 3300006954 | Agricultural Soil | RDRVLRARGFHDVLEPLGPRELAALFPYSVRVVNSGMTLTAVGPE* |
| Ga0079219_116316922 | 3300006954 | Agricultural Soil | FDDVLEPLGPRELASLFPYPVRIVNRGMTLIAVGPE* |
| Ga0075423_116096981 | 3300009162 | Populus Rhizosphere | RLFRARGFDDVLDPLGPGELAALFPYRVRVLNRGLTLIAIGPV* |
| Ga0075423_129534231 | 3300009162 | Populus Rhizosphere | DDVLDPLGPKELAALFPYPVRVINTGMTLIAVGPR* |
| Ga0134062_107268971 | 3300010337 | Grasslands Soil | RLLPFDDVLDPLSARELAALFPYSVRVINTGMTLIAVGPA* |
| Ga0126372_116445332 | 3300010360 | Tropical Forest Soil | GFDDVLDPLGPGELASLFPYRVRVLNRGLTLVAVGPV* |
| Ga0126372_118305942 | 3300010360 | Tropical Forest Soil | LRARGFGDVLEPLGPGQLAALFPYSVRVINTGLTLVAVGPA* |
| Ga0134125_102667193 | 3300010371 | Terrestrial Soil | GPRERVLRARGFHDVLDPLGPRELAALFPYSVRVVNNGMTLTAVGPE* |
| Ga0105239_116082112 | 3300010375 | Corn Rhizosphere | IPFDDVLDPLGPRAFASLFPYDVRVLNRGMTLIAVGPA* |
| Ga0134126_130324882 | 3300010396 | Terrestrial Soil | LEPLGPAELAALFPYPVRILNRGLTLVAVGPDGG* |
| Ga0120118_10460753 | 3300012010 | Permafrost | PPSARDRVVRARGFDDVLDPLGPKELASLFPYSVRVLNTGMTLIAVGPE* |
| Ga0120159_10325583 | 3300012014 | Permafrost | GFDDVLDPLGPKELAALFPYPVRIVNQGMTLVAIGPL* |
| Ga0137382_108372052 | 3300012200 | Vadose Zone Soil | FRARGFDDVLDPLGPKEFAALFPYPVRVLNRGLTLVAVGPV* |
| Ga0137381_108068612 | 3300012207 | Vadose Zone Soil | FDDVLDPLGPKELAALFPYPVRVLNRGLTLVAVGPV* |
| Ga0137370_109555112 | 3300012285 | Vadose Zone Soil | DDVLDPLSAKQLAALFPYSVRVINTGMTLIAVGPA* |
| Ga0137384_101402743 | 3300012357 | Vadose Zone Soil | PAGARERLIPFDDVLDPLGPKELASLFPYSVRVINTGMTLIAVGPK* |
| Ga0137410_114876992 | 3300012944 | Vadose Zone Soil | FDDVLDPLSPKELAALFPYSVRVINTGMTLIAVGPE* |
| Ga0164300_100283833 | 3300012951 | Soil | DRVLRARGFDDVLEPLGPSELASLFPYRVRIVNTGMTLIAVGPE* |
| Ga0126369_130955771 | 3300012971 | Tropical Forest Soil | LFRGRGFDDVLDPLGPGELAALFPYPVEIVSHGMTLVAVGPQ* |
| Ga0134087_102348321 | 3300012977 | Grasslands Soil | TARTRLFRARGFHDVLDPLGPKELAALFPYPVRVLNRGLTLVAVGPV* |
| Ga0134087_104548092 | 3300012977 | Grasslands Soil | RVLRFEDVLDPLGPKDFAALFPYSVRVINTGMTLVAVGPQ* |
| Ga0164308_107008111 | 3300012985 | Soil | DRLFRARGFDDVLDPLGPRELASLFPYPVRIARRGMTLVAVGPV* |
| Ga0164306_114892672 | 3300012988 | Soil | PSGPRERLVPFDDVLDPLGPKDFASLFPYSVRVLNTGMTLIAFGPE* |
| Ga0157369_106639961 | 3300013105 | Corn Rhizosphere | AVRARGFDDVLDPLGPKALAALFPYSVRVINTGMTLIAIGPE* |
| Ga0120172_10384372 | 3300013765 | Permafrost | RVIPFDDVIDPLGPKAFASLFPYEVRVLNRGMTLVAVGPA* |
| Ga0120172_10721092 | 3300013765 | Permafrost | VLRARGFDDVLDPLGPKELASLFPYSVRVLNTGMTLIAVGPE* |
| Ga0181534_104921702 | 3300014168 | Bog | RGFDDVLDPLGPAELAALFPFPVRIVNSGLTLVAAGPL* |
| Ga0075313_10384222 | 3300014267 | Natural And Restored Wetlands | RRDRILRARGFDDVLDPLGPRELATLFPYPVRIVRRGMTLVAVGPA* |
| Ga0182015_104646251 | 3300014495 | Palsa | PGERRSRLLRARGFDDVLDPLGPAALAGLFPYPVRIVNRGLTLIAVGPS* |
| Ga0157376_120429282 | 3300014969 | Miscanthus Rhizosphere | PEAARVRFVPFDDVLDPLGPKDLAALFPYRVRVLNRGMTLIAVGPE* |
| Ga0167649_1219252 | 3300015063 | Glacier Forefield Soil | LPQGPRERLLRFDDVLDPLSAKDLAALFPYRVRVINTGMTLIAVGPE* |
| Ga0167650_10539792 | 3300015203 | Glacier Forefield Soil | LPVAARDRVVRARGFHDVLDPLGPRELASLFPYSVHVLNTGMTLIAVGPE* |
| Ga0132258_109546513 | 3300015371 | Arabidopsis Rhizosphere | GPRRDRLFRARGFDDVLDPLGPSELASLFPYPVRIARRGMTLVAVGPV* |
| Ga0132258_132949152 | 3300015371 | Arabidopsis Rhizosphere | RDPLLRARGFDDVLEPLGPRELASLFPYSVRVVDRGMTLIAVGPE* |
| Ga0132256_1030637362 | 3300015372 | Arabidopsis Rhizosphere | ARDRLVQARGYDDVLDPLGPRELASLFPYPVRVLNRGLTLVAVGPL* |
| Ga0182041_114807431 | 3300016294 | Soil | PTPLREQAIRSRGFDATLDLLGPRELASLFPYSVRVLNRGMTLIAVGPR |
| Ga0182037_116475661 | 3300016404 | Soil | PEPRSRALGRVGWHEVLDPLGPRELASLFPYEVRVLNRGMTLIAIGPA |
| Ga0187786_106272402 | 3300017944 | Tropical Peatland | DDVLQPLGPRELEALFPYPVRVINRGLSLIAVGPR |
| Ga0187823_103593132 | 3300017993 | Freshwater Sediment | PGTLRERLLRSRGFDDVLDPLGPSELASLFPYPVRVLNRGLTLIAVGPV |
| Ga0066662_119151822 | 3300018468 | Grasslands Soil | RGFHDVLDPLGPRELASLFPYSVRIVNRGMTLTAVGPE |
| Ga0066669_107645002 | 3300018482 | Grasslands Soil | FDDVLDPLTPKELAALFPYSVRVINTGMTLIAVGPE |
| Ga0206356_116314961 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GARERLIPFDDVLDPLGPKALAALFPYSVRVINTGMTLIAVGPE |
| Ga0213877_102369861 | 3300021372 | Bulk Soil | RARGFADVLDPLGPRELASLFPYPVRVLNRGMTLIAVGPR |
| Ga0210384_118779621 | 3300021432 | Soil | RALLRARGFDDVLDPLGPRELVALFPYPVRIVSRGMTLVAVGPE |
| Ga0126371_130662511 | 3300021560 | Tropical Forest Soil | RDRLLRARGFADVLEPLGPRELAALFPYPVRVINTGLTLIAVGPA |
| Ga0207692_103203951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FDDVLDPLSAKDLTALFPYRVRVINTGMTLIAIGPE |
| Ga0207685_101377602 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLLPFDDVLDPLTRKELSALFPYSVRVINTGMTLIAVGPE |
| Ga0207705_107012302 | 3300025909 | Corn Rhizosphere | LPAGLRTRAVRARGFDDVLDPLGPKALAALFPYRVRVINTGMTLIAVGPE |
| Ga0207654_111798952 | 3300025911 | Corn Rhizosphere | HWLPKGPRERLLRFDDVLDPLSPKELAALFPYSVRVINTGMTLIAVGPE |
| Ga0207663_111018311 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ARGFDDILEPLGPKELASLFPYSVRVVNRGMTLTAVGPQ |
| Ga0207663_111732772 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ARARLIPYDDVLDPLGPKAFGSLFPYEVRVLNRGMTLIAVGPR |
| Ga0207652_108986411 | 3300025921 | Corn Rhizosphere | ARDRVIPFDDVLDPLGPKAFASLFPYEVRVLNRGMTLVAVGPA |
| Ga0207664_109829661 | 3300025929 | Agricultural Soil | RERLFRARGFDDVLEPLGPAELASLFPYPVRILNNGLTLVAVGPE |
| Ga0207665_115574981 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLPFDDVLDPLSRKELAALFPYSVRVINTGMTLIAVGPE |
| Ga0207678_109282852 | 3300026067 | Corn Rhizosphere | FRARGFDDVLDPLGPRELAALFPYPVRIASRGMTLVAAGPV |
| Ga0209006_110916282 | 3300027908 | Forest Soil | RAQRDRILRARGFDDVLEPLSQTQLASLFPYPVQVVNRGMTLIAIGPK |
| Ga0265326_101972541 | 3300028558 | Rhizosphere | DRILRARGFDDVLEPLSQRELASLFPYPVQVLNRGMTLVAIGPE |
| Ga0265318_103559672 | 3300028577 | Rhizosphere | PPGPRARLIPFDDVLDPLGPKEFAALFPYSVRVINTGMTLIAVGPR |
| Ga0265338_108134921 | 3300028800 | Rhizosphere | LPRGARDPILRARGFHDVLEPLSARELAALFPYPVRVLNRGMTLIAIGPL |
| Ga0311334_118258051 | 3300029987 | Fen | PFDDVLDPLGPKELASLFPYSVRVINTGMTLIAVGHE |
| Ga0265329_101487021 | 3300031242 | Rhizosphere | RLIPFDDVLDPLGPKEFAALFPYSVRVINTGMTLIAVGPR |
| Ga0265327_101350092 | 3300031251 | Rhizosphere | RRRLLRARGFEDVLDPLGPKELAALFPYPVRIVNQAMTLIAVGPQ |
| Ga0265327_102066401 | 3300031251 | Rhizosphere | TRNRALRARGFDDVLDPLGPGELAALFPFPVKIVSRGMTLVAAGPL |
| Ga0318534_107149691 | 3300031544 | Soil | HDVLDPLGPRDLASLFPYSVRVLNRGMTLIAVGPA |
| Ga0318534_108199281 | 3300031544 | Soil | GFDATLDLLGPRELASLFPYSVRVLNRGMTLIAVGPR |
| Ga0318555_102821792 | 3300031640 | Soil | VRARGFDATLDLLGPKELASLFPYSVRVLNRGMTLIAVGPR |
| Ga0318574_103762342 | 3300031680 | Soil | VGWHEVLDPLGPRELASLFPYEVRVLNRGMTLIAIGPA |
| Ga0307469_112308712 | 3300031720 | Hardwood Forest Soil | PAGAARRRLLRARGFDDVLDPLGPRELASLFPYPVRVLNRGLTLVAVGPV |
| Ga0318552_104316842 | 3300031782 | Soil | GFADELAPLGPGQLAALFPYPVRVINTGMTLIAVGPE |
| Ga0306921_122595891 | 3300031912 | Soil | RGFDDVLDPLGPRELASLFPYPVRIVSHGMTLVAVGPA |
| Ga0308175_1003644423 | 3300031938 | Soil | RYEDVLDPLGPKELASLFPYSVRVLNRGMTLIAYGPV |
| Ga0308176_107571931 | 3300031996 | Soil | DRVIPFDDVLDPLGPKAFASLFPYEVRVLNRGMTLVAVGPA |
| Ga0307416_1011960661 | 3300032002 | Rhizosphere | DVVLDPLGPGELASLFPYPVRILRRGMTVVAAGPLKGEA |
| Ga0318559_101002861 | 3300032039 | Soil | LGRVGWHEVLDPLGPRELASLFPYEVRVLNRGMTLIAIGPA |
| Ga0308173_122499821 | 3300032074 | Soil | LPRGPRDRVLRARGFDDVLEPLGPSEFASLFPYRVRIVNTGMTLIAVGPE |
| Ga0335080_122400051 | 3300032828 | Soil | RRRGFDDVLDPLGRRELASLFPYPVRVLGHGMTLVAIGPE |
| Ga0335072_108783942 | 3300032898 | Soil | ADVLDPLGPRELAALFPYPVKIVDRGMTIVAIGPWEPQA |
| Ga0335077_109243291 | 3300033158 | Soil | DDVLDPLGPKDFAALFPYSVRVLNRGMTLIAVGPE |
| Ga0370501_0178467_7_150 | 3300034195 | Untreated Peat Soil | LPAGARERVIPFDDVLDPLGPKELASLFPYSVRVINTGMTLIAVGPQ |
| ⦗Top⦘ |