| Basic Information | |
|---|---|
| Family ID | F095911 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFA |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.43 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 83.81 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF05239 | PRC | 4.76 |
| PF01479 | S4 | 2.86 |
| PF02852 | Pyr_redox_dim | 1.90 |
| PF14019 | DUF4235 | 1.90 |
| PF12770 | CHAT | 1.90 |
| PF13185 | GAF_2 | 1.90 |
| PF13551 | HTH_29 | 0.95 |
| PF13411 | MerR_1 | 0.95 |
| PF01638 | HxlR | 0.95 |
| PF01381 | HTH_3 | 0.95 |
| PF00694 | Aconitase_C | 0.95 |
| PF12840 | HTH_20 | 0.95 |
| PF08241 | Methyltransf_11 | 0.95 |
| PF07730 | HisKA_3 | 0.95 |
| PF02861 | Clp_N | 0.95 |
| PF07690 | MFS_1 | 0.95 |
| PF00884 | Sulfatase | 0.95 |
| PF01841 | Transglut_core | 0.95 |
| PF00589 | Phage_integrase | 0.95 |
| PF03640 | Lipoprotein_15 | 0.95 |
| PF00271 | Helicase_C | 0.95 |
| PF03417 | AAT | 0.95 |
| PF02037 | SAP | 0.95 |
| PF04655 | APH_6_hur | 0.95 |
| PF00011 | HSP20 | 0.95 |
| PF00892 | EamA | 0.95 |
| PF05977 | MFS_3 | 0.95 |
| PF07228 | SpoIIE | 0.95 |
| PF02567 | PhzC-PhzF | 0.95 |
| PF02585 | PIG-L | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.95 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.95 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.95 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.95 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.95 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.95 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.95 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.95 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.95 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.95 |
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.38 % |
| Unclassified | root | N/A | 47.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10213104 | Not Available | 784 | Open in IMG/M |
| 3300004479|Ga0062595_100922338 | Not Available | 739 | Open in IMG/M |
| 3300005332|Ga0066388_102325332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
| 3300005334|Ga0068869_101987933 | Not Available | 522 | Open in IMG/M |
| 3300005435|Ga0070714_100093627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2635 | Open in IMG/M |
| 3300005435|Ga0070714_102227132 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005437|Ga0070710_10633693 | Not Available | 747 | Open in IMG/M |
| 3300005455|Ga0070663_101780400 | Not Available | 552 | Open in IMG/M |
| 3300005602|Ga0070762_11092476 | Not Available | 549 | Open in IMG/M |
| 3300005843|Ga0068860_101711560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300006028|Ga0070717_10482170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1120 | Open in IMG/M |
| 3300006173|Ga0070716_101671262 | Not Available | 525 | Open in IMG/M |
| 3300006176|Ga0070765_101537036 | Not Available | 626 | Open in IMG/M |
| 3300006358|Ga0068871_101080720 | Not Available | 750 | Open in IMG/M |
| 3300006755|Ga0079222_10159895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
| 3300006755|Ga0079222_10185326 | Not Available | 1232 | Open in IMG/M |
| 3300006755|Ga0079222_12037179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Humibacter → Humibacter ginsenosidimutans | 565 | Open in IMG/M |
| 3300006804|Ga0079221_10110283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1370 | Open in IMG/M |
| 3300006806|Ga0079220_10535879 | Not Available | 812 | Open in IMG/M |
| 3300006954|Ga0079219_12475950 | Not Available | 504 | Open in IMG/M |
| 3300009101|Ga0105247_11563581 | Not Available | 540 | Open in IMG/M |
| 3300009545|Ga0105237_10049285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 4234 | Open in IMG/M |
| 3300010154|Ga0127503_10995225 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010320|Ga0134109_10164507 | Not Available | 804 | Open in IMG/M |
| 3300010371|Ga0134125_11655588 | Not Available | 696 | Open in IMG/M |
| 3300010373|Ga0134128_10071081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3989 | Open in IMG/M |
| 3300010373|Ga0134128_11530322 | Not Available | 734 | Open in IMG/M |
| 3300010401|Ga0134121_10127890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 2151 | Open in IMG/M |
| 3300010401|Ga0134121_10244071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1569 | Open in IMG/M |
| 3300010401|Ga0134121_11005185 | Not Available | 819 | Open in IMG/M |
| 3300010861|Ga0126349_1143318 | Not Available | 570 | Open in IMG/M |
| 3300010937|Ga0137776_1631845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Humibacter → Humibacter ginsenosidimutans | 620 | Open in IMG/M |
| 3300011120|Ga0150983_12199694 | Not Available | 578 | Open in IMG/M |
| 3300011120|Ga0150983_15421418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 531 | Open in IMG/M |
| 3300012096|Ga0137389_10644475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 910 | Open in IMG/M |
| 3300012208|Ga0137376_11438758 | Not Available | 580 | Open in IMG/M |
| 3300012356|Ga0137371_10894985 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012683|Ga0137398_10774478 | Not Available | 669 | Open in IMG/M |
| 3300012957|Ga0164303_10215728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1074 | Open in IMG/M |
| 3300012987|Ga0164307_10149493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1535 | Open in IMG/M |
| 3300013104|Ga0157370_10452501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1180 | Open in IMG/M |
| 3300013105|Ga0157369_11857356 | Not Available | 612 | Open in IMG/M |
| 3300013296|Ga0157374_11547331 | Not Available | 687 | Open in IMG/M |
| 3300013307|Ga0157372_10193778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 2354 | Open in IMG/M |
| 3300013307|Ga0157372_13249071 | Not Available | 518 | Open in IMG/M |
| 3300014501|Ga0182024_10147676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3311 | Open in IMG/M |
| 3300017926|Ga0187807_1257187 | Not Available | 573 | Open in IMG/M |
| 3300017932|Ga0187814_10128125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 942 | Open in IMG/M |
| 3300017933|Ga0187801_10491967 | Not Available | 517 | Open in IMG/M |
| 3300017972|Ga0187781_11450233 | Not Available | 508 | Open in IMG/M |
| 3300018006|Ga0187804_10336857 | Not Available | 661 | Open in IMG/M |
| 3300021088|Ga0210404_10038014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
| 3300021180|Ga0210396_10864639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 772 | Open in IMG/M |
| 3300021374|Ga0213881_10535174 | Not Available | 532 | Open in IMG/M |
| 3300021404|Ga0210389_10013304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6350 | Open in IMG/M |
| 3300021406|Ga0210386_11242580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 629 | Open in IMG/M |
| 3300021420|Ga0210394_11141344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 671 | Open in IMG/M |
| 3300021474|Ga0210390_10849928 | Not Available | 753 | Open in IMG/M |
| 3300021479|Ga0210410_10668780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 919 | Open in IMG/M |
| 3300022530|Ga0242658_1180055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300024347|Ga0179591_1068853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3027 | Open in IMG/M |
| 3300025915|Ga0207693_10072817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2690 | Open in IMG/M |
| 3300025916|Ga0207663_10354675 | Not Available | 1111 | Open in IMG/M |
| 3300025916|Ga0207663_10736711 | Not Available | 782 | Open in IMG/M |
| 3300025928|Ga0207700_10072823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2651 | Open in IMG/M |
| 3300025939|Ga0207665_10705189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.36 | 793 | Open in IMG/M |
| 3300025981|Ga0207640_10496356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1016 | Open in IMG/M |
| 3300026142|Ga0207698_10519187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1162 | Open in IMG/M |
| 3300026377|Ga0257171_1081820 | Not Available | 569 | Open in IMG/M |
| 3300027066|Ga0208236_1005596 | Not Available | 785 | Open in IMG/M |
| 3300027171|Ga0207947_1017228 | Not Available | 526 | Open in IMG/M |
| 3300027824|Ga0209040_10095263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
| 3300027908|Ga0209006_10941187 | Not Available | 691 | Open in IMG/M |
| 3300027908|Ga0209006_11137722 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300028742|Ga0302220_10249276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
| 3300028789|Ga0302232_10653541 | Not Available | 516 | Open in IMG/M |
| 3300028799|Ga0307284_10484415 | Not Available | 507 | Open in IMG/M |
| 3300029943|Ga0311340_10395441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1273 | Open in IMG/M |
| 3300030013|Ga0302178_10472616 | Not Available | 550 | Open in IMG/M |
| 3300030503|Ga0311370_11998549 | Not Available | 579 | Open in IMG/M |
| 3300030524|Ga0311357_11533523 | Not Available | 563 | Open in IMG/M |
| 3300030580|Ga0311355_10046862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5119 | Open in IMG/M |
| 3300030580|Ga0311355_10133373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2699 | Open in IMG/M |
| 3300030617|Ga0311356_11350058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300030706|Ga0310039_10048189 | Not Available | 1897 | Open in IMG/M |
| 3300030730|Ga0307482_1097514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 799 | Open in IMG/M |
| 3300030730|Ga0307482_1240633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300031226|Ga0307497_10332351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300031708|Ga0310686_108767758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1695 | Open in IMG/M |
| 3300031819|Ga0318568_10657197 | Not Available | 652 | Open in IMG/M |
| 3300031897|Ga0318520_10456361 | Not Available | 786 | Open in IMG/M |
| 3300032008|Ga0318562_10684829 | Not Available | 590 | Open in IMG/M |
| 3300032009|Ga0318563_10788682 | Not Available | 509 | Open in IMG/M |
| 3300032010|Ga0318569_10596507 | Not Available | 514 | Open in IMG/M |
| 3300032160|Ga0311301_12212602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300032180|Ga0307471_103407702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300032782|Ga0335082_10091996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3022 | Open in IMG/M |
| 3300032783|Ga0335079_12085231 | Not Available | 544 | Open in IMG/M |
| 3300032805|Ga0335078_11822876 | Not Available | 660 | Open in IMG/M |
| 3300032828|Ga0335080_10083246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3549 | Open in IMG/M |
| 3300032954|Ga0335083_10624158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 885 | Open in IMG/M |
| 3300033134|Ga0335073_10015675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10596 | Open in IMG/M |
| 3300033134|Ga0335073_10276062 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300033158|Ga0335077_10285775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1811 | Open in IMG/M |
| 3300033290|Ga0318519_10234681 | Not Available | 1057 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_102131043 | 3300003505 | Forest Soil | MIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLADFSGEELLPLAPGE |
| Ga0062595_1009223381 | 3300004479 | Soil | MSEPGYHDALRILCDDASGDLHRALAAACESVPAWDPVVYLADFAHQMLFPL |
| Ga0066388_1023253321 | 3300005332 | Tropical Forest Soil | VATLTTGATMSTPGFPDALRVLCQDAGGDVHRVLAAACGPVPA |
| Ga0068869_1019879332 | 3300005334 | Miscanthus Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADF |
| Ga0070714_1000936271 | 3300005435 | Agricultural Soil | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAGAAEQ |
| Ga0070714_1022271321 | 3300005435 | Agricultural Soil | MSEPGYHDALRILCQDAGGDLHRVLAAACESVPAWDPVVYLADFAHKVLFPLA |
| Ga0070710_106336932 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADFAHQMLFPL |
| Ga0070663_1017804001 | 3300005455 | Corn Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPL |
| Ga0070762_110924762 | 3300005602 | Soil | MNVPGYPDALRVLREVAGGDLKHMLAAACASIPAWDPAVYLGD |
| Ga0068860_1017115602 | 3300005843 | Switchgrass Rhizosphere | MSEPGYHSALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPLA |
| Ga0070717_104821701 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFAC |
| Ga0070716_1016712622 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLA |
| Ga0070765_1015370363 | 3300006176 | Soil | MREPGYSDALRVLRDAAGGDLQHVITAACEPVPAWDPIIYL |
| Ga0068871_1010807201 | 3300006358 | Miscanthus Rhizosphere | MSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADF |
| Ga0079222_101598951 | 3300006755 | Agricultural Soil | MSEPGYHGALRILCDDASGGLHRALAAACESVPAWDPVVYL |
| Ga0079222_101853263 | 3300006755 | Agricultural Soil | MSEPGYHEALRLLCQDAGVDLHRVLATACEPVPARDP |
| Ga0079222_120371791 | 3300006755 | Agricultural Soil | MSEPGYHDALRALRQDAGGDLHRVLAAACEPVPAWDPVVYLADFAFRA |
| Ga0079221_101102832 | 3300006804 | Agricultural Soil | MSEPGYHDALRLLCQDAGADLHRVLAVACEPVPARDPVVY |
| Ga0079220_105358791 | 3300006806 | Agricultural Soil | MSEPGYPDALRILCHDVGGGLHHALVAACESVPAWDPVVYLADFAHQVLFPLAGD |
| Ga0079219_124759502 | 3300006954 | Agricultural Soil | MSEPGYHGALRILCDDASGGLHRALAAACESVPAWDPVVYLADFAH |
| Ga0105247_115635811 | 3300009101 | Switchgrass Rhizosphere | MSEPGYHDALRILCHDAGGDLHRALAAACESVPAWDPVV |
| Ga0105237_100492855 | 3300009545 | Corn Rhizosphere | MSEPGYHDALRILCDEAGGGLHRALAAACESVPAWDPVVYLADFAHQMLF |
| Ga0127503_109952252 | 3300010154 | Soil | MSEPGYHDALRILCHDAGGDLHRALAAACESVPAWDPVVYLADFA |
| Ga0134109_101645072 | 3300010320 | Grasslands Soil | MSEPGYHEALRLVCQDAGADVHRVLAAACEPVPARDPVVY |
| Ga0134125_116555881 | 3300010371 | Terrestrial Soil | MHSLGSGAAMSEPGYHDALRLLCHDASGDLHHALAAACESVPAWDPVV |
| Ga0134128_100710811 | 3300010373 | Terrestrial Soil | MHSLGSGAAMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDP |
| Ga0134128_115303221 | 3300010373 | Terrestrial Soil | MSEPGYHDALRILCHDAGGDLHHALAAACESVPAWDPVVYLADFAHQMLF |
| Ga0134121_101278901 | 3300010401 | Terrestrial Soil | MSEPGYQDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHK |
| Ga0134121_102440711 | 3300010401 | Terrestrial Soil | MGEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFP |
| Ga0134121_110051852 | 3300010401 | Terrestrial Soil | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLAGDA |
| Ga0126349_11433182 | 3300010861 | Boreal Forest Soil | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPASDPVVYLADFACQMLVPLAA |
| Ga0137776_16318451 | 3300010937 | Sediment | MSEPGYHDALRALRHDAGGDLHRVLAAACGPVPAWDPVVYLADFAFRVLFPLTAGATEQQ |
| Ga0150983_121996942 | 3300011120 | Forest Soil | MREPGYPDALRVLREVTGGDLNQVLAAACEPVPAWDPVVYLADFSGEVCFRWPLR* |
| Ga0150983_154214181 | 3300011120 | Forest Soil | MREPGYPDALRLLREVTGGDLHHLLAAACAAVPAWDPVVY |
| Ga0137389_106444753 | 3300012096 | Vadose Zone Soil | MREPGYPDALRVLREITGGDLHQVLAAACEPVPAWDLVVYLADFSGEVLLPLA |
| Ga0137376_114387581 | 3300012208 | Vadose Zone Soil | MCHLGSEAAMSEPGYHDALGLLCQDAGADLHRVLAAACEPVPARD |
| Ga0137371_108949851 | 3300012356 | Vadose Zone Soil | MSEPGYHEALRLLCEDAGADLHRVLAAACERVPAQDPVVYL |
| Ga0137398_107744782 | 3300012683 | Vadose Zone Soil | MSEPGYHDALRLLCQDAGADLHRVLATACEPVPARDPVVYLADFASQVL |
| Ga0164303_102157283 | 3300012957 | Soil | MSEPGYHDALRILCDDAGGGLHRALVAACESVPALDPVVYLADFAHQMLFPLAGDAAE |
| Ga0164307_101494933 | 3300012987 | Soil | MGEPGYHDALRILCDDAGGGLHRALVAACESVPAWDP |
| Ga0157370_104525011 | 3300013104 | Corn Rhizosphere | MSEPGYHSALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLV |
| Ga0157369_118573562 | 3300013105 | Corn Rhizosphere | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARD |
| Ga0157374_115473311 | 3300013296 | Miscanthus Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAH |
| Ga0157372_101937784 | 3300013307 | Corn Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFP |
| Ga0157372_132490711 | 3300013307 | Corn Rhizosphere | MSEPGYHDALRILCHDAGGDLHRALAAACESVPAW |
| Ga0182024_101476765 | 3300014501 | Permafrost | MREPGYSAALRVLRDAAGGDLQHVLDAACEPVPAWDPVVYLADFSGSVLYPLAIRVAEE |
| Ga0187807_12571872 | 3300017926 | Freshwater Sediment | MREPGYSDALRVFREVTEGDLHQVLAAACEPVPAWDPVVYLGDFSGEVLLPLAAGVAEEA |
| Ga0187814_101281251 | 3300017932 | Freshwater Sediment | MGVPDYPGALWILCQDAGGDLHRALAVACEPVPAWDPVVYLADFSRQVLF |
| Ga0187801_104919672 | 3300017933 | Freshwater Sediment | MGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLADFAHQVLFPLAA |
| Ga0187781_114502332 | 3300017972 | Tropical Peatland | MRMPGYPEALGVLSQDAGGDVHRVLAAACEPVPAWDPVVYLADFAHRV |
| Ga0187804_103368571 | 3300018006 | Freshwater Sediment | MGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLVDFAHQVLFPLAAGTAAAI |
| Ga0210404_100380141 | 3300021088 | Soil | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPAVYLADFACQALVPLAVGAAE |
| Ga0210396_108646393 | 3300021180 | Soil | MREPGYPDALRVLREVTGGDLHQVLAAACAPLPAWDPV |
| Ga0213881_105351741 | 3300021374 | Exposed Rock | MPVPGYPEALRLLCQDAGGEVQRVLAAACASVPAWDPVVYLADFAHRTLFPLTAGL |
| Ga0210389_1001330410 | 3300021404 | Soil | MREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVY |
| Ga0210386_112425801 | 3300021406 | Soil | MREPGYPDALRVLREVTGGDLHYVLAAACGAVPAWD |
| Ga0210394_111413441 | 3300021420 | Soil | MREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPV |
| Ga0210390_108499283 | 3300021474 | Soil | MIQPGYSDALRVLRDAAGGDLHHVIVAACKPIPAWDPIVYLSDFS |
| Ga0210410_106687801 | 3300021479 | Soil | MREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLGDFSGEVLLPLATGV |
| Ga0242658_11800552 | 3300022530 | Soil | VTEPGYHDALRLLCQDAGADLHRVLAVACEPVPARDPVVYLADFA |
| Ga0179591_10688534 | 3300024347 | Vadose Zone Soil | MSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVVPG |
| Ga0207693_100728174 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLA |
| Ga0207663_103546752 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAGA |
| Ga0207663_107367111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADFAHQMLFPLAGDEA |
| Ga0207700_100728231 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAG |
| Ga0207665_107051891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPGYHDALGVLCQDAGADLHRVLAAACAPVPARDPVVYLADFACQVLVPLAA |
| Ga0207640_104963563 | 3300025981 | Corn Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQML |
| Ga0207698_105191872 | 3300026142 | Corn Rhizosphere | MSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLAGDAAEQ |
| Ga0257171_10818201 | 3300026377 | Soil | MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFA |
| Ga0208236_10055963 | 3300027066 | Forest Soil | MIEPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLGDFSGEELLP |
| Ga0207947_10172281 | 3300027171 | Forest Soil | MIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLADFSGEELLP |
| Ga0209040_100952631 | 3300027824 | Bog Forest Soil | MCHLGSGAAMSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVY |
| Ga0209006_109411871 | 3300027908 | Forest Soil | MIEPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLG |
| Ga0209006_111377222 | 3300027908 | Forest Soil | MREPGYSDALRVLRDAAGGDLQHVLDAACEPVPAWDP |
| Ga0302220_102492761 | 3300028742 | Palsa | MIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYVSDFSGEELI |
| Ga0302232_106535411 | 3300028789 | Palsa | MRESGYEPGYPHALRVLREAAGGDLQNVLNAACEPIPAWDPVVYL |
| Ga0307284_104844152 | 3300028799 | Soil | MSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPL |
| Ga0311340_103954411 | 3300029943 | Palsa | MGEPGLYDALRVLREAAGGDLQHVITAACATVPARDPVIYLG |
| Ga0302178_104726161 | 3300030013 | Palsa | MRESGYSDALRVLRDAAGGDLQHVLDAACEPVPAWNPVVYLADFS |
| Ga0311370_119985492 | 3300030503 | Palsa | MREPGYSDALRVLRAAAGGDLQHVLDAACEPVPAWDPVVYLADFSGSVLL |
| Ga0311357_115335231 | 3300030524 | Palsa | MIQPGYSDALRVLRDAAGGDLQHVITAACEPIPAWDPIVYLSDFSGQELIPLA |
| Ga0311355_100468628 | 3300030580 | Palsa | MHEPAYSDALRVLRDAAGGDLQHVIAAACEPVPAWDPIVYLGDFSGEELLPLTPG |
| Ga0311355_101333735 | 3300030580 | Palsa | MIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPI |
| Ga0311356_113500582 | 3300030617 | Palsa | MRESGYSDALRVLRDAAGGDLQHVLDAACEPVPAWNPVVYLADFSGSVLFPLAVR |
| Ga0310039_100481893 | 3300030706 | Peatlands Soil | MGVPDYPGALRILCQDAEGDLQRVLAAACEPVPAWDPVVYLADFSGQVLFPLA |
| Ga0307482_10975143 | 3300030730 | Hardwood Forest Soil | MREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLGDFS |
| Ga0307482_12406332 | 3300030730 | Hardwood Forest Soil | MREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLADFSGEVLLPLATGA |
| Ga0307497_103323511 | 3300031226 | Soil | MSEPGYHDALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPLAA |
| Ga0310686_1087677581 | 3300031708 | Soil | MREPGYSAALRVLRDAAGGDLQQVIAAACEPVPAWDPVVYLG |
| Ga0318568_106571972 | 3300031819 | Soil | MSEPGYHNALRASCDDAGVDLHRVLTAACEPMPAWDPVVYL |
| Ga0318520_104563612 | 3300031897 | Soil | MSEPGYRDALRVVCDDAGVDLHRVLTAACEPLPAWDPVVYLA |
| Ga0318562_106848291 | 3300032008 | Soil | MGQPGYSDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLA |
| Ga0318563_107886821 | 3300032009 | Soil | MPVPGYPEALRVLCQDAGSDVHRVLAAACAPVPAWDPVVYLADFAYQV |
| Ga0318569_105965072 | 3300032010 | Soil | MGQPGYSDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLADFAHQVLFPLAAGVAEEE |
| Ga0311301_122126021 | 3300032160 | Peatlands Soil | MGVPGFPEALRVLCHDAGGDLHQVLAAACEPVPAWDPVVYLVDFAHMVLF |
| Ga0307471_1034077022 | 3300032180 | Hardwood Forest Soil | MSEPGYHSALRVLCQDAGADLHRVLAAACEPLSAR |
| Ga0335082_100919965 | 3300032782 | Soil | MSEPGYREALRVLCDDAAVDLHRVLTAACEPLPAWDPVVYLADFAFQVLFPL |
| Ga0335079_120852312 | 3300032783 | Soil | MGQPGYPDALEVLRQAAGGDLHRVLAAACAPVPAWDPVIYLVDFAHQVLFPLAAGVAEEE |
| Ga0335078_118228761 | 3300032805 | Soil | MSEPGYDDALRVLCDDAGVDLHRVLTAACEPLPAWDPVVYLADFAFQVLFPLAA |
| Ga0335080_100832461 | 3300032828 | Soil | MGVPDYPGALWILCQDAGGDLQRVLAAACEPVPAWDPVVYLADFSRQVLFPLAAGVAAE |
| Ga0335083_106241582 | 3300032954 | Soil | MSEPGYHDALRALRQDAGGDLHRVLAAACEPVPAWDPVVYLADFAFRVLF |
| Ga0335073_1001567514 | 3300033134 | Soil | MHEPGYSDALRVLRDAAGRDLQHVIAAACAPVPAWDPVV |
| Ga0335073_102760621 | 3300033134 | Soil | MGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPGWDPVIYLADF |
| Ga0335077_102857751 | 3300033158 | Soil | MGQPGYPDALGVLRQAAGGDLHRVLAAACGPVPAWDPVIYLADF |
| Ga0318519_102346812 | 3300033290 | Soil | MSEPGYHDALGVLCRDAGGDPHRVLAAACEPVPAWDPVVYLADFAHQVLCPLAA |
| ⦗Top⦘ |