| Basic Information | |
|---|---|
| Family ID | F095892 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00920 | ILVD_EDD | 29.52 |
| PF07681 | DoxX | 3.81 |
| PF07883 | Cupin_2 | 2.86 |
| PF00924 | MS_channel | 2.86 |
| PF14014 | DUF4230 | 1.90 |
| PF03144 | GTP_EFTU_D2 | 0.95 |
| PF01039 | Carboxyl_trans | 0.95 |
| PF13407 | Peripla_BP_4 | 0.95 |
| PF01797 | Y1_Tnp | 0.95 |
| PF01663 | Phosphodiest | 0.95 |
| PF13442 | Cytochrome_CBB3 | 0.95 |
| PF07690 | MFS_1 | 0.95 |
| PF00032 | Cytochrom_B_C | 0.95 |
| PF08448 | PAS_4 | 0.95 |
| PF16640 | Big_3_5 | 0.95 |
| PF01833 | TIG | 0.95 |
| PF02636 | Methyltransf_28 | 0.95 |
| PF15780 | ASH | 0.95 |
| PF11528 | DUF3224 | 0.95 |
| PF05977 | MFS_3 | 0.95 |
| PF05598 | DUF772 | 0.95 |
| PF01019 | G_glu_transpept | 0.95 |
| PF16326 | ABC_tran_CTD | 0.95 |
| PF00293 | NUDIX | 0.95 |
| PF01343 | Peptidase_S49 | 0.95 |
| PF11008 | DUF2846 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 59.05 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 3.81 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 3.81 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.86 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 2.86 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.95 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.95 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.95 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.95 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 0.95 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.95 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.95 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.62 % |
| Unclassified | root | N/A | 32.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001180|JGI12695J13573_1010498 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300001661|JGI12053J15887_10472781 | Not Available | 599 | Open in IMG/M |
| 3300003219|JGI26341J46601_10094844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 876 | Open in IMG/M |
| 3300005445|Ga0070708_101439232 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005445|Ga0070708_102144021 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005554|Ga0066661_10615142 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005555|Ga0066692_10522086 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006050|Ga0075028_100546433 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006086|Ga0075019_10462182 | Not Available | 783 | Open in IMG/M |
| 3300006086|Ga0075019_10751821 | Not Available | 619 | Open in IMG/M |
| 3300006174|Ga0075014_100733693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 578 | Open in IMG/M |
| 3300009088|Ga0099830_10028804 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300009143|Ga0099792_10854109 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009521|Ga0116222_1541659 | Not Available | 511 | Open in IMG/M |
| 3300009523|Ga0116221_1046984 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300009523|Ga0116221_1388051 | Not Available | 607 | Open in IMG/M |
| 3300009643|Ga0116110_1031256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1991 | Open in IMG/M |
| 3300009643|Ga0116110_1126071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300009672|Ga0116215_1005496 | All Organisms → cellular organisms → Bacteria | 6755 | Open in IMG/M |
| 3300009683|Ga0116224_10130753 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300009762|Ga0116130_1105106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300009764|Ga0116134_1185593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 726 | Open in IMG/M |
| 3300010341|Ga0074045_10163127 | Not Available | 1508 | Open in IMG/M |
| 3300010343|Ga0074044_10263389 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300010379|Ga0136449_101978526 | Not Available | 862 | Open in IMG/M |
| 3300010379|Ga0136449_103992993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. 'Peltigera malacea cyanobiont' DB3992 | 551 | Open in IMG/M |
| 3300012096|Ga0137389_10340070 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012202|Ga0137363_10654845 | Not Available | 888 | Open in IMG/M |
| 3300012205|Ga0137362_10184703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1792 | Open in IMG/M |
| 3300012351|Ga0137386_11148150 | Not Available | 546 | Open in IMG/M |
| 3300012361|Ga0137360_10934455 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012582|Ga0137358_10022445 | Not Available | 4078 | Open in IMG/M |
| 3300012683|Ga0137398_11221204 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012927|Ga0137416_11483912 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012971|Ga0126369_11272742 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300014155|Ga0181524_10075060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1990 | Open in IMG/M |
| 3300014155|Ga0181524_10200798 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300014159|Ga0181530_10509476 | Not Available | 598 | Open in IMG/M |
| 3300014169|Ga0181531_10740725 | Not Available | 612 | Open in IMG/M |
| 3300015054|Ga0137420_1478090 | All Organisms → cellular organisms → Bacteria | 6691 | Open in IMG/M |
| 3300015193|Ga0167668_1034203 | Not Available | 1110 | Open in IMG/M |
| 3300015264|Ga0137403_10382173 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300017823|Ga0187818_10089954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1326 | Open in IMG/M |
| 3300017823|Ga0187818_10302492 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300017929|Ga0187849_1106873 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300017948|Ga0187847_10002273 | All Organisms → cellular organisms → Bacteria | 15708 | Open in IMG/M |
| 3300017998|Ga0187870_1137109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300018006|Ga0187804_10217468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300018022|Ga0187864_10093145 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300018030|Ga0187869_10233928 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300018033|Ga0187867_10420891 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018034|Ga0187863_10287981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300018034|Ga0187863_10695924 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018035|Ga0187875_10695722 | Not Available | 534 | Open in IMG/M |
| 3300018040|Ga0187862_10208472 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300018040|Ga0187862_10545276 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300018040|Ga0187862_10655538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300018044|Ga0187890_10121673 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300018047|Ga0187859_10082486 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300018062|Ga0187784_10412834 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300018062|Ga0187784_10951366 | Not Available | 683 | Open in IMG/M |
| 3300018085|Ga0187772_10179250 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300018090|Ga0187770_11332095 | Not Available | 582 | Open in IMG/M |
| 3300019787|Ga0182031_1424446 | Not Available | 1960 | Open in IMG/M |
| 3300019883|Ga0193725_1069003 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Trichomonascaceae → Sugiyamaella → Sugiyamaella lignohabitans | 875 | Open in IMG/M |
| 3300021168|Ga0210406_10997398 | Not Available | 623 | Open in IMG/M |
| 3300021401|Ga0210393_11580795 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021432|Ga0210384_11206662 | Not Available | 661 | Open in IMG/M |
| 3300021474|Ga0210390_10202705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1678 | Open in IMG/M |
| 3300025444|Ga0208189_1007935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2779 | Open in IMG/M |
| 3300025459|Ga0208689_1068158 | Not Available | 682 | Open in IMG/M |
| 3300025498|Ga0208819_1113506 | Not Available | 564 | Open in IMG/M |
| 3300025500|Ga0208686_1030880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae | 1331 | Open in IMG/M |
| 3300025506|Ga0208937_1143790 | Not Available | 506 | Open in IMG/M |
| 3300025507|Ga0208188_1073366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300025579|Ga0207927_1111069 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300026552|Ga0209577_10205277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300026557|Ga0179587_11121833 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027546|Ga0208984_1129523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300027575|Ga0209525_1139151 | Not Available | 560 | Open in IMG/M |
| 3300027676|Ga0209333_1006209 | Not Available | 3979 | Open in IMG/M |
| 3300027703|Ga0207862_1101263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300027854|Ga0209517_10581136 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027889|Ga0209380_10219176 | Not Available | 1118 | Open in IMG/M |
| 3300027905|Ga0209415_10763686 | Not Available | 680 | Open in IMG/M |
| 3300028536|Ga0137415_10252743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1571 | Open in IMG/M |
| 3300028748|Ga0302156_10036500 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300028792|Ga0307504_10294827 | Not Available | 608 | Open in IMG/M |
| 3300028808|Ga0302228_10411668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300028868|Ga0302163_10076870 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300029903|Ga0247271_116364 | Not Available | 932 | Open in IMG/M |
| 3300029943|Ga0311340_10197429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
| 3300030659|Ga0316363_10280417 | Not Available | 671 | Open in IMG/M |
| 3300030737|Ga0302310_10456965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300031234|Ga0302325_12822857 | Not Available | 568 | Open in IMG/M |
| 3300031525|Ga0302326_12052441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 736 | Open in IMG/M |
| 3300031715|Ga0307476_10772714 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031715|Ga0307476_11425898 | Not Available | 503 | Open in IMG/M |
| 3300031720|Ga0307469_12217666 | Not Available | 535 | Open in IMG/M |
| 3300032160|Ga0311301_12894328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. 'Peltigera malacea cyanobiont' DB3992 | 520 | Open in IMG/M |
| 3300032770|Ga0335085_11108689 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300032805|Ga0335078_11609703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300032892|Ga0335081_11652805 | Not Available | 701 | Open in IMG/M |
| 3300033158|Ga0335077_11761388 | Not Available | 583 | Open in IMG/M |
| 3300034091|Ga0326724_0642217 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.95% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12695J13573_10104981 | 3300001180 | Forest Soil | MFKSIVRFLAILGALVIIGTVFAVVAVIGSKGTVPSKTILEANFEQ |
| JGI12053J15887_104727812 | 3300001661 | Forest Soil | MSKLIVRFLAILGALWLIGMVIALVAVIGAKGRVP |
| JGI26341J46601_100948441 | 3300003219 | Bog Forest Soil | VSKIIVRFLAILGALWLIGMVIVLVFVIGSKAKVPSKTILE |
| Ga0070708_1014392321 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKVIVRFLAILGALWLVAMVIMIVAVIGSKGTVPEKTILEADFEQALP |
| Ga0070708_1021440211 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKVIVRFLAILGALWLVAMVIMIVAVIGSKGTVPEKTILEADFEQALPEDI |
| Ga0066661_106151421 | 3300005554 | Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGRVPSKTIL |
| Ga0066692_105220862 | 3300005555 | Soil | MSKLIVRFLAILGALSLIGMVIVLVAVIGAKGRVPSKTILEANFEQTFLE |
| Ga0075028_1005464332 | 3300006050 | Watersheds | MSKAIVRFLAILGALWLVGLGIVLFALMGSKGKVPSKTILEANFEQ |
| Ga0075019_104621822 | 3300006086 | Watersheds | MSKLIVRFLAILGALWLIGMVIMMVAVIGVKGRVPSKTILEANFEQA |
| Ga0075019_107518211 | 3300006086 | Watersheds | MSKLIVRFLAILGALWLIGMVIVLVFVIGAKGKVPSRTILEAN |
| Ga0075014_1007336931 | 3300006174 | Watersheds | MSRVIVRFLAILGALWLIGLVIMMVAIIGSKGRVPSKTILEANLEQS |
| Ga0099830_100288041 | 3300009088 | Vadose Zone Soil | MLKVIVRFLAILGALWLVAMVIMIVAVIGSKGTVPE |
| Ga0099792_108541092 | 3300009143 | Vadose Zone Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANFEQTFLE |
| Ga0116222_15416591 | 3300009521 | Peatlands Soil | MSKAIVRFLAILGAFWLIGMVIVMVAVIGSKGKVTSKTILE |
| Ga0116221_10469841 | 3300009523 | Peatlands Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVP |
| Ga0116221_13880511 | 3300009523 | Peatlands Soil | MSKVIVRFLAILGALWLIGMVIVMVAVIGMKGRVPSKTILEANFEQTF |
| Ga0116110_10312561 | 3300009643 | Peatland | MSKFIVRFLAVLGALWLIGMVIVLVAVIGAKGKVPSKTI |
| Ga0116110_11260712 | 3300009643 | Peatland | MSKLIVRFLAILGALWLIGMVIVLVAVIGVKGKVPSKTILEA |
| Ga0116215_10054961 | 3300009672 | Peatlands Soil | MSKAIVRFLAILGALWLIGMVIVMVAVIGMRGKVP |
| Ga0116224_101307531 | 3300009683 | Peatlands Soil | MSKAIVRFLAILGALWLIGMVIVLVAVIGTKGKVPSKTILEANFEQAFME |
| Ga0116130_11051061 | 3300009762 | Peatland | MSKVIVRFLAILGALWLIGMVIVLVAVIGVKGKVPSKT |
| Ga0116134_11855932 | 3300009764 | Peatland | MSKLIVRFLAILGALWLIGMIIVLVAVIGAKGKVPSKTILEADLEQTF |
| Ga0074045_101631271 | 3300010341 | Bog Forest Soil | MSKAIVRFLAILGALSLIGTAVVMIAVIGVRGKVPSKTILEANF |
| Ga0074044_102633892 | 3300010343 | Bog Forest Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSKTILEANF |
| Ga0136449_1019785261 | 3300010379 | Peatlands Soil | MSKVIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSKTILEANFEQTF |
| Ga0136449_1039929931 | 3300010379 | Peatlands Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSK |
| Ga0137389_103400702 | 3300012096 | Vadose Zone Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGVKGRVPSKTIL |
| Ga0137363_106548451 | 3300012202 | Vadose Zone Soil | MSKAIVRFLAILGALWLIGMVIVMVAVIGVKGKVPSRTILEANFEQSFMED |
| Ga0137362_101847032 | 3300012205 | Vadose Zone Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANF |
| Ga0137386_111481501 | 3300012351 | Vadose Zone Soil | MSKVIVRFLAILGALWLVAMVIMIVAVIGSKGKVPDKTILEADFEQAL |
| Ga0137360_109344551 | 3300012361 | Vadose Zone Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANFEQTF |
| Ga0137358_100224455 | 3300012582 | Vadose Zone Soil | MSKLIVRFLAVLGALWLIGMVIVLVAVIGAKGRVPSK |
| Ga0137398_112212042 | 3300012683 | Vadose Zone Soil | MSKVIVRFLAILGALWLIAMVIVIVAVIGSKGTVPDKTILEA |
| Ga0137416_114839122 | 3300012927 | Vadose Zone Soil | MSKLIVRFFAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANLE |
| Ga0126369_112727421 | 3300012971 | Tropical Forest Soil | MLKAIVRFLAILGALWLIGLAIMLVAVIGAKGKVPQKTILEADLEQPLL |
| Ga0181524_100750601 | 3300014155 | Bog | MSKFIVRFLAILGALWLIGMIIVLVFVIGAKGRVPSKTILEAN |
| Ga0181524_102007982 | 3300014155 | Bog | MSKLVVRFLAILGALWLIGMVIVLVAVIGTKGKVPSKTILEANFE |
| Ga0181530_105094761 | 3300014159 | Bog | MSKLIVRFLAILGALWLIGMVIVMVAVIGWKGRVPSKTILEANFEQAFME |
| Ga0181531_107407251 | 3300014169 | Bog | MSKLIVRFLAILGGLWLIRMVIVLVFVIGAKGRVPSK |
| Ga0137420_14780902 | 3300015054 | Vadose Zone Soil | MSKVIVRFLAILGALWLVAMVIMIVAVIGTKGKVPDKTILEANFENALPRMFRKVRPPS* |
| Ga0167668_10342033 | 3300015193 | Glacier Forefield Soil | MSKLIVRFLAILGALWLITMVIVLVAVIGAKGKVPSKTILEANFEQTFLE |
| Ga0137403_103821731 | 3300015264 | Vadose Zone Soil | MSKAIVRFLAILGALWLIGMVIIMATVIGMKGKVPSKTI |
| Ga0187818_100899543 | 3300017823 | Freshwater Sediment | MSKAIVRFLAILGALWLIGLVIMMVAVIGFKGKVPSKTILEANL |
| Ga0187818_103024921 | 3300017823 | Freshwater Sediment | MSKLFVRFLAILGALWLIGMVIVMVAVIGSKGRVPSKTILEANFEQAFM |
| Ga0187849_11068731 | 3300017929 | Peatland | MSKLIVRFLAILGALWLIGMVIVMVAVIGTKGKVPSKTILEANF |
| Ga0187847_1000227317 | 3300017948 | Peatland | MSKAIVRFLAILGALWLIGMVIVLVTVIGMKGKVPSKTILEANFQEAFPEDIPNT |
| Ga0187870_11371091 | 3300017998 | Peatland | MSKVIVRFLAILGALWLIGMVIVLVAVIGVKGKVPSKTILEANFEQ |
| Ga0187804_102174681 | 3300018006 | Freshwater Sediment | MSKAIVRFLAILGALWLIGMVIVLVAVIGSKGKVPSKTILEASF |
| Ga0187864_100931452 | 3300018022 | Peatland | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSKTIL |
| Ga0187869_102339281 | 3300018030 | Peatland | MSKLIVRFLAILGALGLIGMVIVLVAVIGWKGKVPFKTILEANFE |
| Ga0187867_104208911 | 3300018033 | Peatland | MSKLIVRFLAILGALGLIGMVIVLVAVIGWKGKVPFKTILEANFEQTFL |
| Ga0187863_102879811 | 3300018034 | Peatland | MGKAIVRFLAILGALGLIGMAIMLFAVIGAKGKIPSKTILEADFEQS |
| Ga0187863_106959242 | 3300018034 | Peatland | MSKAIVRFLAILGALSLIGIVIVMVTVIGMRGRVPS |
| Ga0187875_106957221 | 3300018035 | Peatland | MFKAFVRFLAILGALSLIGTVIVMVAVIGVRGRVPSKTILEANFEEAF |
| Ga0187862_102084722 | 3300018040 | Peatland | MSKLVVRFLAILGALWLIGMVIVLVAVIGTKGKVPSKT |
| Ga0187862_105452762 | 3300018040 | Peatland | MSNLIVRFLAILGALWLIGMVIVLVAVIGWKGKVPSKTILEA |
| Ga0187862_106555382 | 3300018040 | Peatland | MSKLIVRFLAILGALWLIGMVIVLVAVIGVKGRVPSKTILEANFEQTFMEDVPDT |
| Ga0187890_101216733 | 3300018044 | Peatland | MGRAIVRFLAILGALGLIGMAIMLFAVIGAKGKIPSKTILEADFEQSFPEEIPDT |
| Ga0187859_100824863 | 3300018047 | Peatland | MSKAIVRFLAILGALGLIGMVIAMVAVIGTKGRVPSKTILEANLEQSFLGTC |
| Ga0187784_104128342 | 3300018062 | Tropical Peatland | MSKIIVRFLAILGALWLIGMVIVLVAVIAAKGKVPSKTILEAD |
| Ga0187784_109513661 | 3300018062 | Tropical Peatland | MSKVIVRFLAILGALWLIGMAIVLLAVIGMKGKVPSKT |
| Ga0187772_101792501 | 3300018085 | Tropical Peatland | MSKLIVRFLAILGALWLIGMIIVLIAVIGAKGKVPSKTILEADLEQPLVE |
| Ga0187770_113320951 | 3300018090 | Tropical Peatland | MSKLIVRFLAILGALWLIGMVITLAYVIGAKGKIPSKTILEANFEQP |
| Ga0182031_14244465 | 3300019787 | Bog | MSKAIVRFLAILGALWLIGMVIVLVAVIGVKGKVPSKTILEA |
| Ga0193725_10690032 | 3300019883 | Soil | MTKAIVRFLAILGALWLVTMVIMIVAVIGSKGKVPDKTILEANFEQA |
| Ga0210406_109973981 | 3300021168 | Soil | MSKLIVRFLAILGALWLITMVIVLVAVIGAKGKVPSKTILEANF |
| Ga0210393_115807952 | 3300021401 | Soil | MSKAIVRFLAVLGALSLAGMVIMLVAVIGKNGRVPFKTILEANFEQSFIEDAP |
| Ga0210384_112066621 | 3300021432 | Soil | VSKLIVRFLAILGALWLITMVIVLVAVTGAKGKVPSKTILEANFEQTFLED |
| Ga0210390_102027051 | 3300021474 | Soil | MSKAIVRFLAILGALWLIGMVIVLVAVIGKKGRVPSKTILEANFEQTFLED |
| Ga0208189_10079351 | 3300025444 | Peatland | MSKVIVRFLAILGALWLIGMVIVLVAVIGLKGKVPSK |
| Ga0208689_10681582 | 3300025459 | Peatland | MSKLIVRFLAILGALWLIGMVIVMVAVIGSKGKVPSKTILEANFEQAFME |
| Ga0208819_11135061 | 3300025498 | Peatland | MSKLIVRFLAILGALWLIGMVIVMVAVIGVKGKVPSKTILEANFEQTFLED |
| Ga0208686_10308801 | 3300025500 | Peatland | MSKLIVRFLAILGALGLIGMVIVMVAVIGTKGRVPSKTILEANFEQTFLE |
| Ga0208937_11437901 | 3300025506 | Peatland | MSKLIVRFLAILGALWLIGMVIVMVAVIGVKGKVPSKTILEANFEQTFLEDAPE |
| Ga0208188_10733661 | 3300025507 | Peatland | MSKFIVRFLAVLGALWLIGMVIVLVAVIGAKGKVPSKTILEANFER |
| Ga0207927_11110692 | 3300025579 | Arctic Peat Soil | MSKLIVRFLAILGALVLIGMVIVLVAVIGSKGKVPSKTILEANFEEAF |
| Ga0209577_102052771 | 3300026552 | Soil | MFKSIVRFLAILGALVLIGMVIAVVAVIGSKGKVPSKTILEANFEQTLMEDVPET |
| Ga0179587_111218332 | 3300026557 | Vadose Zone Soil | MSKVIVRFLAILGALWLIAMVIVIVAVIGSKGTVRDKTIMEANFEQALPEN |
| Ga0208984_11295232 | 3300027546 | Forest Soil | MFKSIVRFLAILGALVLLGTVFAVVAIIGAKGKVPS |
| Ga0209525_11391511 | 3300027575 | Forest Soil | MFRLIVRFLAILGALGLIGLAIVVVAVIGWKGKVPSKTILEANFEQSFLEDA |
| Ga0209333_10062094 | 3300027676 | Forest Soil | MSKAIVRFLAIVGALFLIGLVIVTVTVIGKKGRVP |
| Ga0207862_11012631 | 3300027703 | Tropical Forest Soil | MSSLWKAIVRFLAILGALWLIGMLIVLVTVIGSKGRVP |
| Ga0209517_105811362 | 3300027854 | Peatlands Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGAKGKVP |
| Ga0209380_102191761 | 3300027889 | Soil | MSKAIVRFLAILGALWLIGMVIVLVAVIGKKGRVPSK |
| Ga0209415_107636861 | 3300027905 | Peatlands Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSKTILEANFEQTFM |
| Ga0137415_102527431 | 3300028536 | Vadose Zone Soil | MSKLIVRFFAILGALWLIGMVIVLVAVIGAKGRVPSKTILEANFEQ |
| Ga0302156_100365003 | 3300028748 | Bog | MSKAIIRFLAILGALSLLSTAVVLIAVIGAKGRVPSKTILEADFEQTYLENSPETA |
| Ga0307504_102948271 | 3300028792 | Soil | MSKVIVRFLAILGALWLVAMVIMIVAVIGSKGKVPEKTILEADFEQ |
| Ga0302228_104116681 | 3300028808 | Palsa | MSKAIVRFLAILGALFLIGLVIVTVTVIGKKGRVPSRTILEANFDQTLLE |
| Ga0302163_100768702 | 3300028868 | Fen | MSKVIVRFLAVLGALWLVGLGIVLFALMGAKGKVPSKTILEANFEQSLVEDI |
| Ga0247271_1163641 | 3300029903 | Soil | MSKAIVRFLAILGALSLIGTAVVMIAVIGVRGKVPSKTILEANFEEAFPE |
| Ga0311340_101974293 | 3300029943 | Palsa | MSKLIVRFLAILGALWLIGMVIVLVFVIGSKARVPSR |
| Ga0316363_102804171 | 3300030659 | Peatlands Soil | MSKLIVRFLAILGALWLIGLVIVLVAVIGVKGKVPSKTILEADFEQTFL |
| Ga0302310_104569651 | 3300030737 | Palsa | MSKAIVRFLAILGALFLIGLVIVTVTVIGKKGRVPSRTILEANFDQTLL |
| Ga0302325_128228571 | 3300031234 | Palsa | MSKLIVRFLAILGALALIGMVIVMVVAIGAKGKVPSKTVLEANF |
| Ga0302326_120524412 | 3300031525 | Palsa | MSKAIVRFLAILGALFLIGLVIVTVTVIGKKGRVPSKTILEANFDQTLL |
| Ga0307476_107727141 | 3300031715 | Hardwood Forest Soil | MSKLIVRFLAILGALWLIGMAIVLFAVIRTKGTVPSKTVLEA |
| Ga0307476_114258982 | 3300031715 | Hardwood Forest Soil | MFKLIVRFLAILGALGLIGLAIVLVAVIGVKGRVP |
| Ga0307469_122176661 | 3300031720 | Hardwood Forest Soil | MSKLIVRFLAILGALWLVGMAIVLFAIIRTKGTVPSKTILEANFD |
| Ga0311301_128943282 | 3300032160 | Peatlands Soil | MSKLIVRFLAILGALWLIGMVIVLVAVIGMKGRVPSKTILEANFEQTFLEDVP |
| Ga0335085_111086891 | 3300032770 | Soil | MSKIIVRFLAILGALWIIAMVIMIVAVIGTKGKVPDKTILEANFEQA |
| Ga0335078_116097032 | 3300032805 | Soil | MKLIVRFLAILGALWLVGMAIMLFFVISFKGKVPSKTILEANF |
| Ga0335081_116528052 | 3300032892 | Soil | MSKLIVRFLAILGALWLIGMVIVLFAVIDLKGRVPSKTILEANFEKSFL |
| Ga0335077_117613881 | 3300033158 | Soil | MSKLIVRFLAILGALWLIGMAVVLFVVIRTKGTIPS |
| Ga0326724_0642217_1_141 | 3300034091 | Peat Soil | MSKAIVRFLAILGALFLIGLVIVLAAAIGVKGKVPSKTILEANFEQA |
| ⦗Top⦘ |