Basic Information | |
---|---|
Family ID | F095890 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 41 residues |
Representative Sequence | MRRVLAATAAEFLEFQPLGRRFAVLGRRIIPLFAVTAL |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.95 % |
% of genes near scaffold ends (potentially truncated) | 48.57 % |
% of genes from short scaffolds (< 2000 bps) | 92.38 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.857 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (18.095 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF03143 | GTP_EFTU_D3 | 38.10 |
PF03144 | GTP_EFTU_D2 | 19.05 |
PF00584 | SecE | 12.38 |
PF02357 | NusG | 1.90 |
PF03946 | Ribosomal_L11_N | 0.95 |
PF16320 | Ribosomal_L12_N | 0.95 |
PF03631 | Virul_fac_BrkB | 0.95 |
PF00687 | Ribosomal_L1 | 0.95 |
PF02583 | Trns_repr_metal | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 12.38 |
COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 12.38 |
COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 1.90 |
COG0080 | Ribosomal protein L11 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.95 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.86 % |
Unclassified | root | N/A | 37.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001180|JGI12695J13573_1001290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1861 | Open in IMG/M |
3300001471|JGI12712J15308_10181364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300001593|JGI12635J15846_10905252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300003577|Ga0007416J51690_1083493 | Not Available | 560 | Open in IMG/M |
3300005186|Ga0066676_11033899 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006174|Ga0075014_100790851 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009088|Ga0099830_11457609 | Not Available | 570 | Open in IMG/M |
3300009143|Ga0099792_10526709 | Not Available | 744 | Open in IMG/M |
3300009522|Ga0116218_1117409 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300009524|Ga0116225_1020495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3402 | Open in IMG/M |
3300009698|Ga0116216_10000011 | All Organisms → cellular organisms → Bacteria | 221994 | Open in IMG/M |
3300009824|Ga0116219_10372139 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300009826|Ga0123355_10117586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4133 | Open in IMG/M |
3300009839|Ga0116223_10155696 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300010046|Ga0126384_11417197 | Not Available | 648 | Open in IMG/M |
3300010046|Ga0126384_11706372 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010343|Ga0074044_11028148 | Not Available | 540 | Open in IMG/M |
3300010358|Ga0126370_10300806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. TAS13 | 1272 | Open in IMG/M |
3300010358|Ga0126370_11452842 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300010361|Ga0126378_11144480 | Not Available | 878 | Open in IMG/M |
3300010361|Ga0126378_13052879 | Not Available | 533 | Open in IMG/M |
3300010376|Ga0126381_103163396 | Not Available | 651 | Open in IMG/M |
3300010398|Ga0126383_12124670 | Not Available | 648 | Open in IMG/M |
3300010398|Ga0126383_13378116 | Not Available | 521 | Open in IMG/M |
3300011038|Ga0138547_104195 | Not Available | 590 | Open in IMG/M |
3300011043|Ga0138528_106490 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300011063|Ga0138537_1085987 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300011066|Ga0138524_1146031 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300011070|Ga0138567_1032940 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300011071|Ga0138595_1073034 | Not Available | 969 | Open in IMG/M |
3300011072|Ga0138563_1049272 | Not Available | 681 | Open in IMG/M |
3300011073|Ga0138584_1172545 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300011073|Ga0138584_1173900 | Not Available | 820 | Open in IMG/M |
3300011078|Ga0138565_1097744 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300011084|Ga0138562_1034402 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300011088|Ga0138576_1210737 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300011120|Ga0150983_10850800 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300011120|Ga0150983_11891180 | Not Available | 682 | Open in IMG/M |
3300011120|Ga0150983_15292840 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012206|Ga0137380_10965185 | Not Available | 730 | Open in IMG/M |
3300012211|Ga0137377_11385974 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012212|Ga0150985_118292212 | Not Available | 609 | Open in IMG/M |
3300012354|Ga0137366_10513668 | Not Available | 864 | Open in IMG/M |
3300012361|Ga0137360_11580625 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012971|Ga0126369_10570118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → Tissierellales → Peptoniphilaceae → Finegoldia → Finegoldia magna | 1199 | Open in IMG/M |
3300014201|Ga0181537_10685858 | Not Available | 697 | Open in IMG/M |
3300017822|Ga0187802_10103958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300017937|Ga0187809_10166526 | Not Available | 769 | Open in IMG/M |
3300017942|Ga0187808_10616805 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017955|Ga0187817_10805306 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300017975|Ga0187782_10075225 | Not Available | 2468 | Open in IMG/M |
3300018013|Ga0187873_1224791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300018040|Ga0187862_10745871 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300018062|Ga0187784_11249374 | Not Available | 589 | Open in IMG/M |
3300018433|Ga0066667_11461802 | Not Available | 603 | Open in IMG/M |
3300019256|Ga0181508_1288318 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300019786|Ga0182025_1195098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
3300020078|Ga0206352_10377794 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300020078|Ga0206352_10655830 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300021560|Ga0126371_10125251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2600 | Open in IMG/M |
3300021560|Ga0126371_10437930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
3300021860|Ga0213851_1285730 | Not Available | 600 | Open in IMG/M |
3300021860|Ga0213851_1718421 | Not Available | 645 | Open in IMG/M |
3300021861|Ga0213853_11621112 | Not Available | 658 | Open in IMG/M |
3300022502|Ga0242646_1034800 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300022522|Ga0242659_1035600 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300023046|Ga0233356_1052981 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300024331|Ga0247668_1081213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 655 | Open in IMG/M |
3300025898|Ga0207692_10794773 | Not Available | 618 | Open in IMG/M |
3300025915|Ga0207693_10288889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
3300026335|Ga0209804_1223756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300026335|Ga0209804_1340457 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300026868|Ga0207818_1025876 | Not Available | 508 | Open in IMG/M |
3300027168|Ga0208239_1026550 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300027313|Ga0207780_1034566 | Not Available | 890 | Open in IMG/M |
3300027667|Ga0209009_1067073 | Not Available | 901 | Open in IMG/M |
3300027765|Ga0209073_10291525 | Not Available | 644 | Open in IMG/M |
3300027879|Ga0209169_10305318 | Not Available | 836 | Open in IMG/M |
3300027884|Ga0209275_10381085 | Not Available | 793 | Open in IMG/M |
3300027895|Ga0209624_11131048 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300028450|Ga0189898_1012203 | Not Available | 850 | Open in IMG/M |
3300028678|Ga0302165_10246448 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300028906|Ga0308309_10436699 | Not Available | 1126 | Open in IMG/M |
3300029882|Ga0311368_10458808 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300030058|Ga0302179_10389591 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300030730|Ga0307482_1137054 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300030743|Ga0265461_11673430 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300030776|Ga0075396_1959044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300030815|Ga0265746_1037262 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300030862|Ga0265753_1119314 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300030873|Ga0265751_114828 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031198|Ga0307500_10049531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
3300031753|Ga0307477_11091635 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300032160|Ga0311301_11828350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300032805|Ga0335078_12469974 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300032828|Ga0335080_10557374 | Not Available | 1210 | Open in IMG/M |
3300032828|Ga0335080_11086419 | Not Available | 810 | Open in IMG/M |
3300032898|Ga0335072_10283757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1871 | Open in IMG/M |
3300032898|Ga0335072_11741725 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300033807|Ga0314866_010565 | Not Available | 1223 | Open in IMG/M |
3300033824|Ga0334840_126949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300033828|Ga0334850_000593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 19209 | Open in IMG/M |
3300033887|Ga0334790_001654 | All Organisms → cellular organisms → Bacteria | 18405 | Open in IMG/M |
3300034124|Ga0370483_0037978 | Not Available | 1486 | Open in IMG/M |
3300034199|Ga0370514_003619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3432 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 18.10% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.43% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.90% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.95% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.95% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12695J13573_10012904 | 3300001180 | Forest Soil | MRRMLAATVAEFLKFQPFRRRLPVLGRRIIAFFAITAL* |
JGI12712J15308_101813643 | 3300001471 | Forest Soil | MRRVLAAPVTELLQFQTIRRRFAVLSLRVIPLFAITALQ |
JGI12635J15846_109052523 | 3300001593 | Forest Soil | MLAATAAEFLELQPLRRRLPVLGRRIIPLFAITALQRN |
Ga0007416J51690_10834932 | 3300003577 | Avena Fatua Rhizosphere | RSSRLFHFFMGGVLTATAAELLEFQPLGRRLTVLRRRIIPLFAVTAL* |
Ga0066676_110338993 | 3300005186 | Soil | MRRVLTATVAEFLEFQPLRRRLTVLRRRIIPLFAVTALNVTISRG |
Ga0075014_1007908512 | 3300006174 | Watersheds | MAQLFHFFVRRVLAATVAELLEFQPFGRRLPILGRRVVPLFAITAL* |
Ga0099830_114576091 | 3300009088 | Vadose Zone Soil | HFFVRRVLAAAATEFFELQPFGRRLPILGGRIIPLFAITAL* |
Ga0099792_105267092 | 3300009143 | Vadose Zone Soil | VRRVLAATVTELFEFQPFRRRLPVLGGRIIPLFAITAL* |
Ga0116218_11174091 | 3300009522 | Peatlands Soil | FFMRRVLAATAAEFLEFQPLGRRLPILGRRVVPLFAVTAL* |
Ga0116225_10204951 | 3300009524 | Peatlands Soil | MRRVLAATAAELFEFQPFGRRFAVLGRRIVPLFAVTAL* |
Ga0116216_100000112 | 3300009698 | Peatlands Soil | MLAAAAAEFLELQPLCGRFPVLGGRIIPLFAITAL* |
Ga0116219_103721392 | 3300009824 | Peatlands Soil | HFFVRRMLAAAAAEFLELQPLCGRFPVLGGRIIPLFAITAL* |
Ga0123355_101175868 | 3300009826 | Termite Gut | MTAGIDSRLGDSNDPTGLFHFFMDSVLAATAAEFLELQPLGRRLAVLRGRIIPLFAITAL |
Ga0116223_101556961 | 3300009839 | Peatlands Soil | LLNFFMRRVLAATAAEFLEFQPLGRRLPILGRRIVPLFAVTAL* |
Ga0126384_114171972 | 3300010046 | Tropical Forest Soil | FWVRGTGYWLLHFFMRRMLPALAAEFLEFQPFGRRLPIFRRRIIPVFAITAL* |
Ga0126384_117063721 | 3300010046 | Tropical Forest Soil | MLAAEAAIFLEFQPLCRFLLILGRNVIAVFAITTLQNN |
Ga0074044_110281482 | 3300010343 | Bog Forest Soil | VRRVLAATAAEFLELQPLRGRLPVLGGRVVPLFAITAL* |
Ga0126370_103008062 | 3300010358 | Tropical Forest Soil | RLFHFFMGGVLTATAAELFEFQPLGRRFAILRCRIVPLFAVTAL* |
Ga0126370_114528421 | 3300010358 | Tropical Forest Soil | MWGVLAATAAEFLEFQPLRGRLPVFRGRVVPLFALTTL* |
Ga0126378_111444802 | 3300010361 | Tropical Forest Soil | MGGVLTATAAEFLEFQPLGRRFAVLRRRIVPLFAVTAL* |
Ga0126378_130528791 | 3300010361 | Tropical Forest Soil | MGGVLTATAAEFLEFQPLGRRLAVLRRRIVPLFAITAL* |
Ga0126381_1031633962 | 3300010376 | Tropical Forest Soil | MGGVLTATPAEFLEFQPLGRRFAVLRRRIIPLFAVTAL* |
Ga0126383_121246701 | 3300010398 | Tropical Forest Soil | NLLHFFVRRVLAATAAEFLEFQPLGRRLPVLGRRVIALFAITAL* |
Ga0126383_133781161 | 3300010398 | Tropical Forest Soil | MGGVLTATATEFLKFQPLGRRFAVLRCRVVPLFAVTAL* |
Ga0138547_1041951 | 3300011038 | Peatlands Soil | LAATAAELLEFQPLGRRFAVLGRRIVPLFAITAL* |
Ga0138528_1064902 | 3300011043 | Peatlands Soil | MARWPDLFHFFVRRVLAATVAELLELQPFGRRLPIFGGRVVPLFAVTAL* |
Ga0138537_10859872 | 3300011063 | Peatlands Soil | LHFFMRRVLAATAAELLEFQPLGRRLPILGRRVVPLFAVAAL* |
Ga0138524_11460312 | 3300011066 | Peatlands Soil | MLAATAAELLEFQPLGRRLPILGRRVVPLFAVTAL* |
Ga0138567_10329401 | 3300011070 | Peatlands Soil | MAQLFHFFVRRVLAATVAEFLEFQPFRRRFAVLGRRIVPLFAITAL* |
Ga0138595_10730341 | 3300011071 | Peatlands Soil | FFMRRVLAATAAEFLEFQPLGRRLPILGRRIVPLFAVTAL* |
Ga0138563_10492722 | 3300011072 | Peatlands Soil | FHFFMRRVLAATAAELFEFQPFGRRFAVLGRRIVPLFAVTAL* |
Ga0138584_11725452 | 3300011073 | Peatlands Soil | LNFFMRRVLAATAAEFLEFQPLGRRLPILGRRIVPLFAVTAL* |
Ga0138584_11739002 | 3300011073 | Peatlands Soil | RVLAATAAEFLEFQPFRCRLAVLGCRVIAFFAITAL* |
Ga0138565_10977441 | 3300011078 | Peatlands Soil | FFVRRVLAATAAEFLELQPLRGRFTVLGGRVVPLFAVTAL* |
Ga0138562_10344022 | 3300011084 | Peatlands Soil | VLAATAAEFLEFQPLGRRLPILGRRIVPLFAVTAL* |
Ga0138576_12107372 | 3300011088 | Peatlands Soil | MAQLFHFFVRRVLAATVAEFLEFQPFRRRFAVLGRRIVPLFAITTL* |
Ga0150983_108508001 | 3300011120 | Forest Soil | MRRVLAATVAEFLEFQPFRRRFAVLGSRIVPLFAITAL* |
Ga0150983_118911801 | 3300011120 | Forest Soil | IAQLFHFLVRRVLAATVAEFLELQPFRRRFAVLGRRIIPLFAVTAL* |
Ga0150983_152928401 | 3300011120 | Forest Soil | RMLAAAAAEFLELQPFRRRLTVLGRRIIPLFAITAL* |
Ga0137380_109651851 | 3300012206 | Vadose Zone Soil | PGTGYCLFHFFVRRVLAATVAKLLEFQPFRRRLPVLGRRIVPLFAVTAL* |
Ga0137377_113859741 | 3300012211 | Vadose Zone Soil | FHFFVRRVLAATAAEFLEFEPLGRRFAVLRRRIVTLFAVTAL* |
Ga0150985_1182922121 | 3300012212 | Avena Fatua Rhizosphere | GIQPSFHFFVRGVLTATAAEFLELQPLGRRLPVLRRRIIPLFAITAL* |
Ga0137366_105136682 | 3300012354 | Vadose Zone Soil | FHFFMRRMLAATAAEFLEFQPLRRRLPILGRRVVPLFAVTAL* |
Ga0137360_115806251 | 3300012361 | Vadose Zone Soil | VRGMLTATPAEFLEFQPLGRRFAVLRRRIVPLFAVTAL* |
Ga0126369_105701182 | 3300012971 | Tropical Forest Soil | MGGVLPATAAEFLEFQPLGRRFAVLRRRIVPLFAVTAL* |
Ga0181537_106858583 | 3300014201 | Bog | RRVLAATAAELLELQPFRRRLAVLGRRIIPLFAITAL* |
Ga0187802_101039584 | 3300017822 | Freshwater Sediment | MLAATAAEFLEFQPLGRRFAVLGRRVVPLFAITAL |
Ga0187809_101665262 | 3300017937 | Freshwater Sediment | MSGVLTATAAEFFEFQPLGRGLAVLGRRIIPLFAVTAL |
Ga0187808_106168051 | 3300017942 | Freshwater Sediment | MARSQISRFSFHFFMRRMLAATAAEFLEFQPLGRRFAVLGRRVVPLFAITAL |
Ga0187817_108053061 | 3300017955 | Freshwater Sediment | MAQLFHFLMRRVLAATGAEFLEFQPLGRRLPVLGRRVIPLFAVTAL |
Ga0187782_100752255 | 3300017975 | Tropical Peatland | MRRVLAAAAAEFLELQPLGRRLPVLGRRIVPLFAITAL |
Ga0187873_12247911 | 3300018013 | Peatland | MRRMLAATAAEFLELQPFRRRLPVLGRRIIPLFAITALQRNN |
Ga0187862_107458712 | 3300018040 | Peatland | MRRMLAATVAELFELQPLRRSLPVLGGRIIPLFAITAL |
Ga0187784_112493741 | 3300018062 | Tropical Peatland | KLFDLFVRRVLAATTAEFLEFQPLSRRLLVLGGRVVPLFALTTL |
Ga0066667_114618022 | 3300018433 | Grasslands Soil | GPDLFHFFVRRVLAALATELVEFQTLGRGLLVLGRRIVPVFAITAL |
Ga0181508_12883181 | 3300019256 | Peatland | MRRMLAATSAEFLEFQPLGRRLPILGRRIIPLFAVTAL |
Ga0182025_11950981 | 3300019786 | Permafrost | LQNSIQIYFHFFVRRVLAATAAEFFELQPLGRRFPILGRRIIPLFAVTAL |
Ga0206352_103777942 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | NCQLLFAVLFHFFMRRMLPATLAELLKFQTPRRGFLVLGRRIVPLFAVAAL |
Ga0206352_106558301 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | FWLIANCQLLFAVLLHFFMRRMLPATLAELLKFQTSRRGLLVLGRRIVPLFAVAAL |
Ga0126371_101252512 | 3300021560 | Tropical Forest Soil | MGGVLTATAAEFLEFQPLGRRFAVLRRRIVPLFAVTAL |
Ga0126371_104379304 | 3300021560 | Tropical Forest Soil | MQLFHFFVGGVLAATAAEFLELQPLSRRLAVLRGRVVPLFAITAL |
Ga0213851_12857302 | 3300021860 | Watersheds | MLAATAAELFEFQPLGRRFAVLGRRVVPLFAVTAL |
Ga0213851_17184212 | 3300021860 | Watersheds | MGGVLAATAAEFLEFQPLGRRFAVLRCRIVPLFAVTAL |
Ga0213853_116211122 | 3300021861 | Watersheds | MLAATAAELLEFQPLGRRFAVLGRRVVPLFAITAL |
Ga0242646_10348002 | 3300022502 | Soil | MRRVLAATAAELLELQPLGRRLPIFGRRIVPLFAVTAL |
Ga0242659_10356002 | 3300022522 | Soil | AITQLFHFLMRRVLTATVAEFLELQPFRRRFAVLGRRIVPLFAVTAL |
Ga0233356_10529812 | 3300023046 | Soil | MLAATATELLKLQPLRRRLPVLGRRIIPLFAITAL |
Ga0247668_10812133 | 3300024331 | Soil | MGGVLAATAAELLEFQPLGRRFAVLRRRIVPLFAITAL |
Ga0207692_107947731 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KLQNLFHFFVRGVLTATAAEFFEFQPLGRRLPVLRGRIVPFFAITAL |
Ga0207693_102888892 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGVLAATAAEFLEFQPLGRRFAVLRRRIIPLFAVTAL |
Ga0209804_12237561 | 3300026335 | Soil | VRRVLAATAAEFLEFEPLGRRFAVLRRRIVPLFAVTAL |
Ga0209804_13404571 | 3300026335 | Soil | MRRVLTATAAELLELQPLGRRLTVLRCRIVPFFAVTAL |
Ga0207818_10258763 | 3300026868 | Tropical Forest Soil | VRGVLAATAAEFLEFQPLGRRLPVFGRRVIAFFAITAL |
Ga0208239_10265503 | 3300027168 | Forest Soil | MRRVLPATVAEFLEFQPFRRRFAVLGRRVIPLFAVTAL |
Ga0207780_10345662 | 3300027313 | Tropical Forest Soil | PTATTRASVLFNLFVRGVLAATAAEFLEFQPLGRRLPVFGRRVIAFFAITAL |
Ga0209009_10670732 | 3300027667 | Forest Soil | MRRVLAATVAELFELQPFRRRLPVLSRRIIPLFAITAL |
Ga0209073_102915251 | 3300027765 | Agricultural Soil | MGGVLAATAAEFLEFQPLGRRFAVLRRRIIPLFAVTAL |
Ga0209169_103053181 | 3300027879 | Soil | LFDLFVRRMLAATIAELLKLQPFRRRLTVLGRRIIPLFAITAL |
Ga0209275_103810852 | 3300027884 | Soil | FPLTQLFHFFVRRVLPATAAEFLELQPLGRRLAVLGRRIVPLFAITAL |
Ga0209624_111310481 | 3300027895 | Forest Soil | MAESPDFPDLFHFFMRRVLAAAVAELLELQPLRRRLPVLSRRIIPLFAITAL |
Ga0189898_10122031 | 3300028450 | Peatlands Soil | ITQLFHFFVRRVLAATAAEFLEFQPFRCRLAVLGCRVIAFFAITAL |
Ga0302165_102464481 | 3300028678 | Fen | VRRVLAAPATELLLLNPVRCRLTILHRRIVPLFAITAL |
Ga0308309_104366992 | 3300028906 | Soil | AQDSRLFHFFMRRVLAATAAEFLEFQPLGRRFAVLGRRIVPLFAITAL |
Ga0311368_104588082 | 3300029882 | Palsa | MTECFNESMALFHFFVRRVLAATAAELLELQPLGGRLPVLGSRVIPLFAITAL |
Ga0302179_103895911 | 3300030058 | Palsa | MALFHFFVRRVLAATAAELLELQPLGGRLPVLGSRVIPLFAITAL |
Ga0307482_11370543 | 3300030730 | Hardwood Forest Soil | VRRVLAAAAAEFFEFQPLGRRLAVLRCRIVPLFAVTAL |
Ga0265461_116734303 | 3300030743 | Soil | MRRVLAATVAEFLEFQPFRGRFAVLGRRIVPLFAIAAL |
Ga0075396_19590441 | 3300030776 | Soil | VLAATAAEFLEFQSLGRRFAVLRRRIVPLFAVTAL |
Ga0265746_10372622 | 3300030815 | Soil | MRRVLAATVAELFELQPFGGRFTVLGGRIIALFAITAL |
Ga0265753_11193142 | 3300030862 | Soil | MALFHFFVRRVLAATAAELFELQPLRGRLPVLGGRIIPLFAITAL |
Ga0265751_1148281 | 3300030873 | Soil | MAQLFHFFVRRVLAATVAEFLEFQALRCRFAVLGRRVVPLFAITAL |
Ga0307500_100495311 | 3300031198 | Soil | MRRVLAATAAELFEFQPLGRRFAVLRGRIVPLFAVTAL |
Ga0307477_110916352 | 3300031753 | Hardwood Forest Soil | QLFHFFMRRVLAAAAAEFLEFQPLGRRLPILGRRIVPLFAITAL |
Ga0311301_118283501 | 3300032160 | Peatlands Soil | MRRVLPAAPAKLFQLQPVRFGFPVLGGRVIPLFAITA |
Ga0335078_124699742 | 3300032805 | Soil | VRRMLPATGAELLKLQSLRCRFTVLRRRIIPLFAITAL |
Ga0335080_105573742 | 3300032828 | Soil | NWLLNFFVRRVLPATPAEFLEFQPVRRRLAVLGRRVIALFAITAL |
Ga0335080_110864192 | 3300032828 | Soil | RGLFNLFMGGVLTATAAEFLEFQPLSRRFAVLRCRIVPLFAITAL |
Ga0335072_102837571 | 3300032898 | Soil | LLFNFFVRRVLAATAAEFLELQPLSCRFAVLGRRIIPLFAITAL |
Ga0335072_117417251 | 3300032898 | Soil | MRRVLAATAAEFLEFQPLGRRFAVLGRRIIPLFAVTAL |
Ga0314866_010565_1060_1176 | 3300033807 | Peatland | MGGVLAATAAEFLEFQPLGRRLAVLRGRIVPLFAITAL |
Ga0334840_126949_572_685 | 3300033824 | Soil | MRRMLAATAAEFLELQPFRRRLPVLGRRIIPLFAITAL |
Ga0334850_000593_18779_18886 | 3300033828 | Soil | MLAATVAEFFELQPFRRRLTVLGGRIIPLFAITAL |
Ga0334790_001654_660_767 | 3300033887 | Soil | MLTAAAAEFLELQPLGRRLPILGGRIVSFFAVTAL |
Ga0370483_0037978_99_206 | 3300034124 | Untreated Peat Soil | MLAAAATEFFEFQPFRSRLPVLGGRIIPLFAITAL |
Ga0370514_003619_235_351 | 3300034199 | Untreated Peat Soil | MRRVLAAAATELFKFKAFGRRLPVLGGRIIPLFAITAL |
⦗Top⦘ |