| Basic Information | |
|---|---|
| Family ID | F095869 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 49 residues |
| Representative Sequence | ASDFPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 89.52 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.381 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 34.29 |
| PF01042 | Ribonuc_L-PSP | 26.67 |
| PF04909 | Amidohydro_2 | 6.67 |
| PF13482 | RNase_H_2 | 3.81 |
| PF01565 | FAD_binding_4 | 2.86 |
| PF02146 | SIR2 | 1.90 |
| PF04972 | BON | 1.90 |
| PF01315 | Ald_Xan_dh_C | 1.90 |
| PF01797 | Y1_Tnp | 1.90 |
| PF00881 | Nitroreductase | 0.95 |
| PF04255 | DUF433 | 0.95 |
| PF08915 | tRNA-Thr_ED | 0.95 |
| PF00515 | TPR_1 | 0.95 |
| PF02069 | Metallothio_Pro | 0.95 |
| PF08031 | BBE | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 26.67 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.90 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.95 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.29 % |
| Unclassified | root | N/A | 5.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17045356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1081 | Open in IMG/M |
| 2162886012|MBSR1b_contig_13401870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0753455 | Not Available | 2985 | Open in IMG/M |
| 3300000890|JGI11643J12802_12268423 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300002128|JGI24036J26619_10108825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300005169|Ga0066810_10184483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 516 | Open in IMG/M |
| 3300005183|Ga0068993_10341504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005289|Ga0065704_10243029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300005356|Ga0070674_100101594 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300005518|Ga0070699_100553883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300005518|Ga0070699_101487361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300005536|Ga0070697_100255879 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300005575|Ga0066702_10737779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005844|Ga0068862_101305767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300006049|Ga0075417_10250689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 849 | Open in IMG/M |
| 3300006175|Ga0070712_100213241 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300006844|Ga0075428_100633639 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006845|Ga0075421_100529998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1395 | Open in IMG/M |
| 3300006852|Ga0075433_10853450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300006881|Ga0068865_101033082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300006904|Ga0075424_102341462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300007004|Ga0079218_10240037 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300007076|Ga0075435_101819222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300009012|Ga0066710_101655996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300009078|Ga0105106_10743051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300009078|Ga0105106_11243856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300009094|Ga0111539_13257634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300009098|Ga0105245_11069081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300009156|Ga0111538_10667928 | Not Available | 1317 | Open in IMG/M |
| 3300009162|Ga0075423_10012630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 8196 | Open in IMG/M |
| 3300009168|Ga0105104_10643633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300009609|Ga0105347_1007376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3859 | Open in IMG/M |
| 3300009678|Ga0105252_10242365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300009814|Ga0105082_1122074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010043|Ga0126380_11128042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300010043|Ga0126380_12042470 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010047|Ga0126382_10786891 | Not Available | 809 | Open in IMG/M |
| 3300010047|Ga0126382_11297757 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010362|Ga0126377_10390793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1399 | Open in IMG/M |
| 3300010397|Ga0134124_10774902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 956 | Open in IMG/M |
| 3300010397|Ga0134124_11395996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300011332|Ga0126317_11081854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300011397|Ga0137444_1053290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300011437|Ga0137429_1012055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2463 | Open in IMG/M |
| 3300012039|Ga0137421_1095354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300012469|Ga0150984_120883195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300012924|Ga0137413_10970033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300012929|Ga0137404_10932516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300012930|Ga0137407_12238739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300012931|Ga0153915_10469360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300012976|Ga0134076_10174490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 891 | Open in IMG/M |
| 3300013096|Ga0157307_1029989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300014265|Ga0075314_1000187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9865 | Open in IMG/M |
| 3300014883|Ga0180086_1025188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1350 | Open in IMG/M |
| 3300014884|Ga0180104_1003730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3240 | Open in IMG/M |
| 3300015254|Ga0180089_1041252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 894 | Open in IMG/M |
| 3300015374|Ga0132255_105198948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300015374|Ga0132255_105663537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300017966|Ga0187776_10182309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300018063|Ga0184637_10307599 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300018063|Ga0184637_10324200 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300018063|Ga0184637_10763378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300018082|Ga0184639_10228684 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300018082|Ga0184639_10250560 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300018422|Ga0190265_11914969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300018422|Ga0190265_13016095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. CHAB 5844 | 562 | Open in IMG/M |
| 3300019208|Ga0180110_1174948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300020003|Ga0193739_1042256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1179 | Open in IMG/M |
| 3300020018|Ga0193721_1006222 | All Organisms → cellular organisms → Bacteria | 3125 | Open in IMG/M |
| 3300020065|Ga0180113_1290544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1099 | Open in IMG/M |
| 3300021051|Ga0206224_1022653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300022534|Ga0224452_1047205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1274 | Open in IMG/M |
| 3300025569|Ga0210073_1059375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300025925|Ga0207650_10763974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300025936|Ga0207670_10163363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1664 | Open in IMG/M |
| 3300026121|Ga0207683_12077638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300026535|Ga0256867_10344309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300027395|Ga0209996_1033811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300027722|Ga0209819_10126534 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300027840|Ga0209683_10598304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300027862|Ga0209701_10452428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300027873|Ga0209814_10016034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3005 | Open in IMG/M |
| 3300027909|Ga0209382_10762784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300027952|Ga0209889_1004826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3668 | Open in IMG/M |
| 3300028380|Ga0268265_10499803 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300030006|Ga0299907_10368277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300030570|Ga0247647_1162863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031226|Ga0307497_10545789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031469|Ga0170819_14627909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300031538|Ga0310888_10976843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031548|Ga0307408_100164404 | Not Available | 1766 | Open in IMG/M |
| 3300031720|Ga0307469_11681293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300031852|Ga0307410_10211381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1487 | Open in IMG/M |
| 3300031858|Ga0310892_10156760 | Not Available | 1327 | Open in IMG/M |
| 3300031962|Ga0307479_11552108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031965|Ga0326597_10258422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2005 | Open in IMG/M |
| 3300032001|Ga0306922_10685331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300032003|Ga0310897_10664672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300032005|Ga0307411_10129687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300032005|Ga0307411_10748118 | Not Available | 856 | Open in IMG/M |
| 3300032075|Ga0310890_10217790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1322 | Open in IMG/M |
| 3300032163|Ga0315281_11778785 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032174|Ga0307470_10609893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300033433|Ga0326726_10651705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300033486|Ga0316624_12268487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.57% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.95% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01350130 | 2088090014 | Soil | MTTSRDLELLGDDCLFWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRKISYXNPKRLYA |
| MBSR1b_0772.00003400 | 2162886012 | Miscanthus Rhizosphere | FQCGEEMTTGRDLELLGDECLFWASDFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRI |
| ICChiseqgaiiDRAFT_07534554 | 3300000033 | Soil | CLFWASDFPHEGIVDMSKAVEEFLSRDDIPASAKKKISYDNAKKLYGL* |
| JGI11643J12802_122684235 | 3300000890 | Soil | FQCGEEMTTSRDLELLGTECLFWASDFPHEGIVDMSKAVKEFLSREDIPESAKRKISHDNPKRLYGL* |
| JGI24036J26619_101088252 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | IVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL* |
| Ga0066810_101844832 | 3300005169 | Soil | FWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRKISYDNPKRLYAL* |
| Ga0068993_103415042 | 3300005183 | Natural And Restored Wetlands | LGDECLFWASDFPHEGIVSMKKAVQEFLDRDDIPMASKRKISYDNPKKLYAL* |
| Ga0065704_102430293 | 3300005289 | Switchgrass Rhizosphere | SDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL* |
| Ga0070674_1001015941 | 3300005356 | Miscanthus Rhizosphere | LFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL* |
| Ga0070699_1005538831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DFPHEGIVSMKKAVDEFLERDDIPAASKRKIGRENPKKLYRL* |
| Ga0070699_1014873612 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRI* |
| Ga0070697_1002558794 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ASDFPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL* |
| Ga0066702_107377791 | 3300005575 | Soil | CGEEMTTSRDLELLGDACLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRL* |
| Ga0068862_1013057671 | 3300005844 | Switchgrass Rhizosphere | EGIVSMSKAVKEFLDREDIPEGAKRKISYENPKRLYRI* |
| Ga0075417_102506893 | 3300006049 | Populus Rhizosphere | DMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL* |
| Ga0070712_1002132414 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ECLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI* |
| Ga0075428_1006336391 | 3300006844 | Populus Rhizosphere | FPHEGIVDMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL* |
| Ga0075421_1005299981 | 3300006845 | Populus Rhizosphere | CLFWASDFPHEGIVSMKKAVDEFLDRHDIPEASKRKIGRENPKMLYRL* |
| Ga0075433_108534501 | 3300006852 | Populus Rhizosphere | FPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL* |
| Ga0068865_1010330822 | 3300006881 | Miscanthus Rhizosphere | FWASDFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRL* |
| Ga0075424_1023414622 | 3300006904 | Populus Rhizosphere | PHEGIVNMRKAVDEFLDREDISATAKKKISYDNPKKLYRL* |
| Ga0079218_102400374 | 3300007004 | Agricultural Soil | DECLFWASDFPHEGIVDMSKAVNEFLSREDIPTGAKRKISYDNPKRLYRL* |
| Ga0075435_1018192222 | 3300007076 | Populus Rhizosphere | ASDFPHEGILDMATAVKEFLTREDIPAEAKYKIGNENPRRLYGLG* |
| Ga0066710_1016559961 | 3300009012 | Grasslands Soil | HEGIVDMSKAVNEFLSREDIPETSKRKISYDNPKRLYGL |
| Ga0105106_107430512 | 3300009078 | Freshwater Sediment | GEEMTTSRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDREDIPEASKRKISYDNPKKLYGL* |
| Ga0105106_112438562 | 3300009078 | Freshwater Sediment | SMKKAVDEFVEREDIPEAAKRKISYDNPKRLYAL* |
| Ga0111539_132576341 | 3300009094 | Populus Rhizosphere | QVYFQCGEEMTTGRDLELLGDQCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL* |
| Ga0105245_110690811 | 3300009098 | Miscanthus Rhizosphere | FQCGEESTTRRDLEILGDGCLVWASDFPHEGIVNMAKAAGAFITRPDIPESSKRKIAEENPQRLYNLS* |
| Ga0111538_106679281 | 3300009156 | Populus Rhizosphere | QCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL* |
| Ga0075423_1001263013 | 3300009162 | Populus Rhizosphere | ELLGDECLFWASEFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI* |
| Ga0105104_106436331 | 3300009168 | Freshwater Sediment | WPNRKWASDFPHEGIVDMAKAVREFLEREDIPDAAKRKITYDNAKRLYGL* |
| Ga0105347_10073765 | 3300009609 | Soil | CLFWASDFPHEGIVSMKKAVDEFVEREDIPEAAKRKISYDNPKRLYGL* |
| Ga0105252_102423651 | 3300009678 | Soil | DECLFWASDFPHEGIVSMKKAVQEFLDREDIPETSKRKISYDNPKKLYAL* |
| Ga0105082_11220741 | 3300009814 | Groundwater Sand | GDECLFWASDFPHEGIVSMKKAVQEFLDRDDIPEPAKRKISYDNPKKLYGL* |
| Ga0126380_111280421 | 3300010043 | Tropical Forest Soil | MTTSRDLELLGDECLFWASDFPHEGIVSMGNAVKEFLDRDDISDASKQKISYDNPKRLYAL* |
| Ga0126380_120424701 | 3300010043 | Tropical Forest Soil | MAAAVKEFLTREDIPLEAKRKIAGDNPKRLYGIRN* |
| Ga0126382_107868912 | 3300010047 | Tropical Forest Soil | YFQCGEELTTQRDLELLGDHCMLWATNFPHEGIVDMAAAVKEFLTREDIPLEAKRKIAGDNPKRLYGIRN* |
| Ga0126382_112977572 | 3300010047 | Tropical Forest Soil | MITRRDLELLGDECPFWPSDFTHEGIVDIAKAVNELLDRKDILEPAKRKISYDNPKNLYKI* |
| Ga0126377_103907933 | 3300010362 | Tropical Forest Soil | MTTRRDLELLGDECPFWPSDFTHEGIVDIAKAVNELLDRKDILEPAKRKISYDNPKNLYKI* |
| Ga0134124_107749023 | 3300010397 | Terrestrial Soil | CLFWASDFPHEGIVSMGKAVEEFLEREDIPEPAKRKISYDNPKRLYGL* |
| Ga0134124_113959962 | 3300010397 | Terrestrial Soil | GEEMTTSRDLELLGDECLFWASDFPHEGIVDMSKAVKEFLGRDDIPERAKHKISYENPKRLYRL* |
| Ga0126317_110818541 | 3300011332 | Soil | TDMRKAVQEFTTREDIPESAKRKISYDNPKKLYRL* |
| Ga0137444_10532902 | 3300011397 | Soil | CLFWASDFPHEGIVSMKKAVQEFLDRNDIPEASKRKISYDNPKKLYGL* |
| Ga0137429_10120551 | 3300011437 | Soil | SRDLELLGDECLFWASDFPHEGIVSMKKAVQEFLDREDIPETSKRKISYDNPKKLYAL* |
| Ga0137421_10953543 | 3300012039 | Soil | EGIADMTKAVREFLDRRDISEASKRKISYDNPKRLYAL* |
| Ga0150984_1208831951 | 3300012469 | Avena Fatua Rhizosphere | FWASDFPHEGITDMRKAVQEFTGREDIPEPAKRKISYDNPKKLYRL* |
| Ga0137413_109700331 | 3300012924 | Vadose Zone Soil | ASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKNLYRL* |
| Ga0137404_109325161 | 3300012929 | Vadose Zone Soil | SRDLELLGDDCLFWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRNISYDNPKRLYVL* |
| Ga0137407_122387392 | 3300012930 | Vadose Zone Soil | EGIVDMSKAVNEFLSREDIPEASKGKISYDNPKRLYGL* |
| Ga0153915_104693604 | 3300012931 | Freshwater Wetlands | ASDFPHEGIVDMRKAVNEFLERDDIPPAAKRKISYDNPKRLYRL* |
| Ga0134076_101744901 | 3300012976 | Grasslands Soil | IYFQCGEELTTRRDLELLGDHCLLWASDFPHEGITDMATAVKQFLMREDIPPESKRKIASENPKSLYATAR* |
| Ga0157307_10299893 | 3300013096 | Soil | VDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL* |
| Ga0075314_10001871 | 3300014265 | Natural And Restored Wetlands | EECLFWASDFPHEGIVDMGKAVKEFLSREDISEAAKQKISYENPKRLYRL* |
| Ga0180086_10251883 | 3300014883 | Soil | EEMTTGRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDRDDIPTAAKRKISYDNPKRLYGL* |
| Ga0180104_10037306 | 3300014884 | Soil | LFWASDFPHEGIVDMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL* |
| Ga0180089_10412521 | 3300015254 | Soil | DMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL* |
| Ga0132255_1051989482 | 3300015374 | Arabidopsis Rhizosphere | IVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI* |
| Ga0132255_1056635372 | 3300015374 | Arabidopsis Rhizosphere | DMSKAVNEFLSREDIPEAAKRKISYDNPKRLYGL* |
| Ga0187776_101823091 | 3300017966 | Tropical Peatland | LFWASDFPHEGIVSMKKAVQEFLDREDIPQAAKRKISYDNPKRLYGL |
| Ga0184637_103075993 | 3300018063 | Groundwater Sediment | SDFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYGL |
| Ga0184637_103242003 | 3300018063 | Groundwater Sediment | PHEGIVDMGKAVKDFLQRQDIPNGSKRKISYDNPKRLYAL |
| Ga0184637_107633781 | 3300018063 | Groundwater Sediment | SDFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYRL |
| Ga0184639_102286843 | 3300018082 | Groundwater Sediment | DFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYGL |
| Ga0184639_102505603 | 3300018082 | Groundwater Sediment | FWASDFPHEGIVDMGKAVKDFLQRQDIPNGSKRKISYDNPKRLYAL |
| Ga0190265_119149691 | 3300018422 | Soil | SDFPHEGIVDMSKAVHEFLSRADIPAGAKRKISYDNPKRLYRI |
| Ga0190265_130160951 | 3300018422 | Soil | DHCLFWASDFPHEGIVDMTKAVKEFLSRDDIPASSKKKISYDNAKRLYGL |
| Ga0180110_11749482 | 3300019208 | Groundwater Sediment | VSMKKAVQEFLDRNDIPEASKRKIGRENPKKLYRL |
| Ga0193739_10422563 | 3300020003 | Soil | LLGDECLFWASDFPHEGIVDMSRAVREFLDRDDIPEPAKRKISYENPKRLYRL |
| Ga0193721_10062221 | 3300020018 | Soil | ELLGDECLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI |
| Ga0180113_12905443 | 3300020065 | Groundwater Sediment | LGDECLFWASDFPHEGIVDMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL |
| Ga0206224_10226531 | 3300021051 | Deep Subsurface Sediment | TGRDLELLGDECLFWASDFPHEGIVSMKKAVQEFLDREDIPQVSKRKISYDNPKKLYGL |
| Ga0224452_10472051 | 3300022534 | Groundwater Sediment | IVDMAKAVKEFLDREDIPDAAKRKISYENPKRLYAL |
| Ga0210073_10593752 | 3300025569 | Natural And Restored Wetlands | LELLGDGCLFWASDFPHEGIVSMKKAVQEFLDRDDIPAASKRKISYDNPKKLYAL |
| Ga0207650_107639742 | 3300025925 | Switchgrass Rhizosphere | PHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL |
| Ga0207670_101633634 | 3300025936 | Switchgrass Rhizosphere | FGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYGL |
| Ga0207683_120776381 | 3300026121 | Miscanthus Rhizosphere | LLGDQCLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI |
| Ga0256867_103443093 | 3300026535 | Soil | PRASKLIERGQLYFQCGEEMTTSRDLDLLGDECLFWASDFPHEGIVDMAKAVSEFLERKDIPAASKLKIGYDNPKKLYAL |
| Ga0209996_10338113 | 3300027395 | Arabidopsis Thaliana Rhizosphere | WASDFPHEGIVDMSKAVKEFLSREDIPESAKRKISHDNPKRLYGL |
| Ga0209819_101265342 | 3300027722 | Freshwater Sediment | MTTSRDLELLGDDCLFWAADLPHEGIVDMAKAVREFLEREDIPDAAKRKISDDNAKDFYG |
| Ga0209683_105983041 | 3300027840 | Wetland Sediment | FWASDFPHEGIVSMGKVVQEFVERDDIPEASKRKISYDNPKRLYGL |
| Ga0209701_104524283 | 3300027862 | Vadose Zone Soil | MTTSRDLELLGDHCLFWASDFPHEGIVDMAKAVKEFMNREDIPEASKRKISYDNPKRLYG |
| Ga0209814_100160341 | 3300027873 | Populus Rhizosphere | ELLGDECLFWASDFPHEGIVDMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL |
| Ga0209382_107627841 | 3300027909 | Populus Rhizosphere | MTTSRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDRHDIPEASKRKIGRENPKMLYR |
| Ga0209889_10048265 | 3300027952 | Groundwater Sand | DFPHEGIVDMAKAVQEFLDRKDIPDAAKRKISYDNPKRLYAL |
| Ga0268265_104998033 | 3300028380 | Switchgrass Rhizosphere | CGEEMTTGRDLELLGDECLFWASDFPHEGIVSMSKAVKEFLDREDIPEGAKRKISYENPKRLYRI |
| Ga0299907_103682771 | 3300030006 | Soil | DECLFWASDFPHEGIVDMARAVNEFLERNDIPPSSKLKIGYDNPKRLYAL |
| Ga0247647_11628631 | 3300030570 | Soil | QCGEEMTTSRDLDLLGDDCLFWASDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL |
| Ga0307497_105457891 | 3300031226 | Soil | FWASDFPHEGIVSMKKAVDEFVEREDIPEAAKRKISYDNPKRLYAL |
| Ga0170819_146279091 | 3300031469 | Forest Soil | EEMTTSRDLELLGDGCLFWASDFPHEGIVDMAKAVKEFLDRKDILEPAKRKISYDNAKKLYRL |
| Ga0310888_109768431 | 3300031538 | Soil | WASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL |
| Ga0307408_1001644042 | 3300031548 | Rhizosphere | GIVDMSKAVQEFLSRDDIPASSKKKIGYDNAKKLYGL |
| Ga0307469_116812931 | 3300031720 | Hardwood Forest Soil | LELLGDDCLFWASDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL |
| Ga0307410_102113811 | 3300031852 | Rhizosphere | TGRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLEREDIPDVAKRKISYDNPKRLYSL |
| Ga0310892_101567601 | 3300031858 | Soil | DLELLGDQCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL |
| Ga0307479_115521082 | 3300031962 | Hardwood Forest Soil | SDFPHEGILDMAAAVKEFLTREDIPVASKHKIGNENPRRLYGLG |
| Ga0326597_102584221 | 3300031965 | Soil | SDFPHEGIVDMSKAVNEFLGREDISAASKRKISYDNPKKLYGL |
| Ga0306922_106853311 | 3300032001 | Soil | QCLFWASDFPHEGIVDMRKAVNEFLSREDIPEAAKRKISYDNPKRLYRL |
| Ga0310897_106646722 | 3300032003 | Soil | PHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRL |
| Ga0307411_101296871 | 3300032005 | Rhizosphere | ELLGDECLFWASDFPHEGIVSMKKAVDEFLEREDIPDVAKRKISYDNPKKLYSL |
| Ga0307411_107481182 | 3300032005 | Rhizosphere | LLGDQCLFWASDFPHEGIVDMSKAVQEFLSRDDIPALSKKKIGYDNAKKLYGL |
| Ga0310890_102177901 | 3300032075 | Soil | DFPHEGIVSMKKAVDEFLEREDIPDAAKRKISYDNPKRLYSL |
| Ga0315281_117787852 | 3300032163 | Sediment | VVSMKKAVQEFLDRDDIPAASKRKISYDNPKKLYGL |
| Ga0307470_106098931 | 3300032174 | Hardwood Forest Soil | MTTSRDLELLGDECLFWASDFPHEGIVNMSKAVNEFLSREDIPEAAKRKISYDNPKKLYR |
| Ga0326726_106517053 | 3300033433 | Peat Soil | GRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLERDDIPEAAKRKISYDNPKRLYAL |
| Ga0316624_122684872 | 3300033486 | Soil | DECLFWASDFPHEGIVDMSKAVNEFLERDDIPPAAKRKISYDNPKRLYRL |
| ⦗Top⦘ |