| Basic Information | |
|---|---|
| Family ID | F095842 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 51 residues |
| Representative Sequence | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRF |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.31 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.048 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.381 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 46.00% Coil/Unstructured: 54.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03441 | FAD_binding_7 | 12.38 |
| PF06114 | Peptidase_M78 | 10.48 |
| PF17164 | DUF5122 | 3.81 |
| PF00201 | UDPGT | 1.90 |
| PF04226 | Transgly_assoc | 1.90 |
| PF06966 | DUF1295 | 1.90 |
| PF08327 | AHSA1 | 1.90 |
| PF00005 | ABC_tran | 1.90 |
| PF00875 | DNA_photolyase | 1.90 |
| PF08240 | ADH_N | 1.90 |
| PF03807 | F420_oxidored | 1.90 |
| PF05088 | Bac_GDH | 0.95 |
| PF05974 | DUF892 | 0.95 |
| PF07731 | Cu-oxidase_2 | 0.95 |
| PF13460 | NAD_binding_10 | 0.95 |
| PF10011 | DUF2254 | 0.95 |
| PF07876 | Dabb | 0.95 |
| PF08338 | DUF1731 | 0.95 |
| PF00480 | ROK | 0.95 |
| PF06723 | MreB_Mbl | 0.95 |
| PF00089 | Trypsin | 0.95 |
| PF02653 | BPD_transp_2 | 0.95 |
| PF03073 | TspO_MBR | 0.95 |
| PF13466 | STAS_2 | 0.95 |
| PF00027 | cNMP_binding | 0.95 |
| PF01326 | PPDK_N | 0.95 |
| PF02469 | Fasciclin | 0.95 |
| PF13602 | ADH_zinc_N_2 | 0.95 |
| PF01118 | Semialdhyde_dh | 0.95 |
| PF12680 | SnoaL_2 | 0.95 |
| PF12695 | Abhydrolase_5 | 0.95 |
| PF03364 | Polyketide_cyc | 0.95 |
| PF13458 | Peripla_BP_6 | 0.95 |
| PF13561 | adh_short_C2 | 0.95 |
| PF00501 | AMP-binding | 0.95 |
| PF13191 | AAA_16 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 14.29 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 3.81 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.90 |
| COG2020 | Protein-S-isoprenylcysteine O-methyltransferase Ste14 | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.90 |
| COG3752 | Steroid 5-alpha reductase family enzyme | General function prediction only [R] | 1.90 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.95 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.95 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.95 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.95 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 0.95 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.05 % |
| Unclassified | root | N/A | 20.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100702171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1529 | Open in IMG/M |
| 3300000956|JGI10216J12902_101182459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300000956|JGI10216J12902_110366688 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300002239|JGI24034J26672_10090984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300003203|JGI25406J46586_10231484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300004157|Ga0062590_100782577 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300004157|Ga0062590_101922499 | Not Available | 611 | Open in IMG/M |
| 3300005093|Ga0062594_100061812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
| 3300005337|Ga0070682_101552977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300005341|Ga0070691_10187123 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005365|Ga0070688_100073063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2199 | Open in IMG/M |
| 3300005436|Ga0070713_101118421 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005439|Ga0070711_100147945 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300005440|Ga0070705_101236512 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005441|Ga0070700_100996255 | Not Available | 689 | Open in IMG/M |
| 3300005466|Ga0070685_11366194 | Not Available | 543 | Open in IMG/M |
| 3300005539|Ga0068853_101532335 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005764|Ga0066903_107733765 | Not Available | 553 | Open in IMG/M |
| 3300005843|Ga0068860_100397110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
| 3300005883|Ga0075299_1046215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300006031|Ga0066651_10714907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300006175|Ga0070712_101201306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300006581|Ga0074048_13188850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300006581|Ga0074048_13290662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300006605|Ga0074057_11885216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300006606|Ga0074062_12824367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300006755|Ga0079222_11435881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300006806|Ga0079220_10956601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 673 | Open in IMG/M |
| 3300007076|Ga0075435_101670905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300009148|Ga0105243_11926016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 624 | Open in IMG/M |
| 3300009156|Ga0111538_13502266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300009156|Ga0111538_13770858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300009156|Ga0111538_13872517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300009162|Ga0075423_13156152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300009177|Ga0105248_11020738 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300009553|Ga0105249_12103615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300009840|Ga0126313_10727406 | Not Available | 805 | Open in IMG/M |
| 3300010154|Ga0127503_10643976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1651 | Open in IMG/M |
| 3300010227|Ga0136219_1019184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300010373|Ga0134128_11021945 | Not Available | 913 | Open in IMG/M |
| 3300010373|Ga0134128_11603393 | Not Available | 716 | Open in IMG/M |
| 3300010399|Ga0134127_12273891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010399|Ga0134127_12855854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300012091|Ga0136625_1253566 | Not Available | 594 | Open in IMG/M |
| 3300012884|Ga0157300_1021017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300012898|Ga0157293_10069123 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 837 | Open in IMG/M |
| 3300012906|Ga0157295_10170940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300012910|Ga0157308_10042325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1147 | Open in IMG/M |
| 3300012911|Ga0157301_10446330 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012943|Ga0164241_10031495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4018 | Open in IMG/M |
| 3300012951|Ga0164300_10912967 | Not Available | 556 | Open in IMG/M |
| 3300012958|Ga0164299_10162226 | Not Available | 1250 | Open in IMG/M |
| 3300012985|Ga0164308_10174668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1613 | Open in IMG/M |
| 3300012989|Ga0164305_12064200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300013308|Ga0157375_13573777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300014254|Ga0075312_1162627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300014326|Ga0157380_11312343 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300015077|Ga0173483_10402122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300015371|Ga0132258_10787278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2397 | Open in IMG/M |
| 3300015371|Ga0132258_12453334 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300015371|Ga0132258_13989951 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300015372|Ga0132256_100987203 | Not Available | 958 | Open in IMG/M |
| 3300015373|Ga0132257_103083184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300015373|Ga0132257_104120330 | Not Available | 529 | Open in IMG/M |
| 3300015374|Ga0132255_101101693 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300015374|Ga0132255_106335525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300017965|Ga0190266_10383588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 772 | Open in IMG/M |
| 3300018055|Ga0184616_10186981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300018072|Ga0184635_10080936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300018073|Ga0184624_10023121 | Not Available | 2340 | Open in IMG/M |
| 3300018469|Ga0190270_11336875 | Not Available | 760 | Open in IMG/M |
| 3300018481|Ga0190271_12184927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300018481|Ga0190271_12298658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300022901|Ga0247788_1075574 | Not Available | 647 | Open in IMG/M |
| 3300025899|Ga0207642_10525893 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300025907|Ga0207645_11014563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300025908|Ga0207643_11142405 | Not Available | 502 | Open in IMG/M |
| 3300025912|Ga0207707_10194909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300025913|Ga0207695_11001924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300025917|Ga0207660_11054780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300025925|Ga0207650_11489115 | Not Available | 575 | Open in IMG/M |
| 3300025926|Ga0207659_11421989 | Not Available | 594 | Open in IMG/M |
| 3300025927|Ga0207687_10574233 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300025934|Ga0207686_10081568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2112 | Open in IMG/M |
| 3300025934|Ga0207686_11748419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300025935|Ga0207709_10617033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300025940|Ga0207691_10009136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9512 | Open in IMG/M |
| 3300026023|Ga0207677_10780046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300026035|Ga0207703_11657641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300026095|Ga0207676_10884618 | Not Available | 875 | Open in IMG/M |
| 3300028379|Ga0268266_10444732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1231 | Open in IMG/M |
| 3300028596|Ga0247821_10463251 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300028597|Ga0247820_10958409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300030336|Ga0247826_10473773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300031854|Ga0310904_10376816 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031908|Ga0310900_10458439 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300031908|Ga0310900_11048349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300031938|Ga0308175_100266609 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300031939|Ga0308174_10898345 | Not Available | 748 | Open in IMG/M |
| 3300031996|Ga0308176_11834173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
| 3300032770|Ga0335085_12134103 | Not Available | 565 | Open in IMG/M |
| 3300032782|Ga0335082_10117865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2608 | Open in IMG/M |
| 3300033475|Ga0310811_11096643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300033550|Ga0247829_10111538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2076 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010227 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2 | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1007021711 | 3300000956 | Soil | MIGWETSERVLESGAFESRQRVLVPEPVVEASEAGARTLGVTYWQAVDRFTR |
| JGI10216J12902_1011824592 | 3300000956 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRF |
| JGI10216J12902_1103666882 | 3300000956 | Soil | MVGGVTGWETSERVLESGGFESRQRVLVAETVVEASEAGARTLGVTYWQAVDRFTRG |
| JGI24034J26672_100909841 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWETSERVLESGGFESRQRVLVAKPVVEASEAGARTLGVTYWQAV |
| JGI25406J46586_102314841 | 3300003203 | Tabebuia Heterophylla Rhizosphere | VIGWETSERVLESGGFESRQRVLVAEPVVEASEAGARALGVTYWRAVDR |
| Ga0062590_1007825772 | 3300004157 | Soil | LANGGGGVTGWETSERVLESGDFESRQRVLVAVPVVEASEAGARTLGVTYWQAV |
| Ga0062590_1019224991 | 3300004157 | Soil | VTGWETSERVLESGGFESRQGVLVGEPVVEASEAGARTLGVTYW |
| Ga0062594_1000618121 | 3300005093 | Soil | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRF |
| Ga0070682_1015529773 | 3300005337 | Corn Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRA |
| Ga0070691_101871232 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRLTRG |
| Ga0070688_1000730631 | 3300005365 | Switchgrass Rhizosphere | MTGWETSERVLESGGFESRQRVLVAKPVVEASEAGARTLGVTYW |
| Ga0070713_1011184212 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG |
| Ga0070711_1001479454 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGWETSERVLESGAFESRQRLLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVR |
| Ga0070705_1012365121 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVT |
| Ga0070700_1009962551 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGWETSERVLESGGFESRQRVLVVEPMVEASEAGARTLGVTYWQA |
| Ga0070685_113661942 | 3300005466 | Switchgrass Rhizosphere | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTR |
| Ga0068853_1015323352 | 3300005539 | Corn Rhizosphere | MAAIDWETSERVLESGGFESRQRVLVAQPAVEASESGARTLGIVYWHAVDRVTRG |
| Ga0066903_1077337652 | 3300005764 | Tropical Forest Soil | LIGWETSERVLESGAFESRQRVLVAEAAVEASEAGARTLGITYWQAV |
| Ga0068860_1003971101 | 3300005843 | Switchgrass Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASAAGARTLGVTYWQAVDGF |
| Ga0075299_10462151 | 3300005883 | Rice Paddy Soil | VTGWETSERVLESGGFESRQRVLVAEPAVEASEAGARTLGVTYWQAVDRFTR |
| Ga0066651_107149071 | 3300006031 | Soil | MAVDGVTGWETLERVLESGGFESRQRVLVAEPVAEASEAGARTLGVTYWQ |
| Ga0070712_1012013062 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRASWT |
| Ga0074048_131888502 | 3300006581 | Soil | MTMAAVTGWETSERVLESGGFESRQRVLVTEPVVEASEAGARTLGVTYWQAVHDFT |
| Ga0074048_132906621 | 3300006581 | Soil | VTGWETSERVLESGGFESRQRVLVVEPVVEASEAGARTLGVTYWQAVD |
| Ga0074057_118852161 | 3300006605 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQ |
| Ga0074062_128243673 | 3300006606 | Soil | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG |
| Ga0079222_114358812 | 3300006755 | Agricultural Soil | VTGWETSERVLESGRFESRQRVLVAEPVVEASEAGARSL |
| Ga0079220_109566011 | 3300006806 | Agricultural Soil | MTGWETSERVLESGGFESRQRVFVGEPVVEASEAGARTLGVTYWQAVDGFTRGF |
| Ga0075435_1016709051 | 3300007076 | Populus Rhizosphere | MGVDGVTGWATSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG |
| Ga0105243_119260162 | 3300009148 | Miscanthus Rhizosphere | MTGWETSERVLESGGFESRQRVLVPEPVVEASESGARTLGVTYWQAVDGFTRGAV |
| Ga0111538_135022661 | 3300009156 | Populus Rhizosphere | VSGWETSERVLESGGFESRQRMLVPGPVVEASEAGARTLGVTY |
| Ga0111538_137708582 | 3300009156 | Populus Rhizosphere | VTGWETSERLLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAV |
| Ga0111538_138725171 | 3300009156 | Populus Rhizosphere | LTGWETSERVLESGGFESRQRVLVVQPVVKASEAGARTLGVTYWQAVDRFTRGG |
| Ga0075423_131561522 | 3300009162 | Populus Rhizosphere | VTGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRL |
| Ga0105248_110207381 | 3300009177 | Switchgrass Rhizosphere | VTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFT |
| Ga0105249_121036151 | 3300009553 | Switchgrass Rhizosphere | VIGWETSERVFASGGFESRQRVLVAEPVVEASEAGARSLGVSYWQAV |
| Ga0126313_107274061 | 3300009840 | Serpentine Soil | MTEWQTSERVLESGAVESDQRVLMGEPAVEESAAGARVLGVTY |
| Ga0127503_106439763 | 3300010154 | Soil | VTGWETSERVRESGGFESRQRVLVAEPVVEASGAGARTLGVTYWQAVDRFTRGGVRASW |
| Ga0136219_10191842 | 3300010227 | Soil | ESGGFASRQRVLVREPVVEASEAGARTLGVTYWQAVDRVTRGVIRASWTGGGAS* |
| Ga0134128_110219451 | 3300010373 | Terrestrial Soil | MAAEGLTGWETLERVLESGGFESRQRVLVKEPVVEASEAGARTLGITYWRAVD |
| Ga0134128_116033932 | 3300010373 | Terrestrial Soil | VTGWETSERVLESGAFESRQRLLVAEPVVEASEAGARTLGVTYWQAV |
| Ga0134127_122738911 | 3300010399 | Terrestrial Soil | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRASW |
| Ga0134127_128558541 | 3300010399 | Terrestrial Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRASW |
| Ga0136625_12535662 | 3300012091 | Polar Desert Sand | MKGWEANERVLESGGFESRHRVLVDDIVVEASEAGARVLGVTYWQAVDR |
| Ga0157300_10210171 | 3300012884 | Soil | LTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWHAVDRFTRGGVR |
| Ga0157293_100691231 | 3300012898 | Soil | MAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY |
| Ga0157295_101709403 | 3300012906 | Soil | DYPSPMAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGFVRANWRAVEAS* |
| Ga0157308_100423253 | 3300012910 | Soil | VTGWETSEHVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRA |
| Ga0157301_104463301 | 3300012911 | Soil | VTGWETSERVLESGAFESRQRVLVGEPVVEASEAGARTLGVTYWQAVDRFTRGFVRA |
| Ga0164241_100314951 | 3300012943 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGIRASWTGG |
| Ga0164300_109129671 | 3300012951 | Soil | VTGWETSERVLESGAFESRQRVLVGEPVVEASDAGARTLGVTYWQAVDR |
| Ga0164299_101622263 | 3300012958 | Soil | VTGWETSERVLESGAFESRQRVLVGEPVVESSEAGARTLGVTYWQ |
| Ga0164301_106311801 | 3300012960 | Soil | VLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQA |
| Ga0164308_101746681 | 3300012985 | Soil | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY |
| Ga0164305_120642001 | 3300012989 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVR |
| Ga0157375_135737772 | 3300013308 | Miscanthus Rhizosphere | MVVPLTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRAS |
| Ga0075312_11626271 | 3300014254 | Natural And Restored Wetlands | VTGWETSERVLESGGFESRQRVLVAEPAVEASEAGARTLGVTYWQAVDRFTRGW |
| Ga0157380_113123432 | 3300014326 | Switchgrass Rhizosphere | MDKHWLREWETSERLLESGGFESRQRVLVAEPAVEASDSGARWLGVTYWRAVAG |
| Ga0173483_104021221 | 3300015077 | Soil | MAAEGLTGWETLERVLESGGFESRQRVLVAQPVVEASEAGARTLGVTYWQAVDRFTR |
| Ga0132258_107872781 | 3300015371 | Arabidopsis Rhizosphere | VTGWETSERVLESGAFESRQRVLAADPVVEASEAGARTLGVTYWQ |
| Ga0132258_124533341 | 3300015371 | Arabidopsis Rhizosphere | MVVDGVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFT |
| Ga0132258_139899512 | 3300015371 | Arabidopsis Rhizosphere | LADGGSGVTGWETSERVLESGAFESRQRVLVAEPVVEASESGARALGVT |
| Ga0132256_1009872032 | 3300015372 | Arabidopsis Rhizosphere | MGWETSERVLESGGFESFQRVLVAEPVVEASEAGARTLGVTYWQAVDRVTH |
| Ga0132257_1030831841 | 3300015373 | Arabidopsis Rhizosphere | VTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFTR |
| Ga0132257_1041203301 | 3300015373 | Arabidopsis Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVT |
| Ga0132255_1011016933 | 3300015374 | Arabidopsis Rhizosphere | VSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRL |
| Ga0132255_1063355252 | 3300015374 | Arabidopsis Rhizosphere | VTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSRGVTYWQAVDRFTRG |
| Ga0190266_103835881 | 3300017965 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLG |
| Ga0184616_101869811 | 3300018055 | Groundwater Sediment | MTGWETSERVLESGAFESRQRVFVAEPAVEASEAGARTL |
| Ga0184635_100809361 | 3300018072 | Groundwater Sediment | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAV |
| Ga0184624_100231211 | 3300018073 | Groundwater Sediment | MTGWETSERVLESGGFESRQRVFVAEPVVEASEAGARTLGVTYWQAVDRFTRGG |
| Ga0190270_113368751 | 3300018469 | Soil | VTGWETSERLLESGGFESRQRVLVAEPVVEASEAGARTLG |
| Ga0190271_121849271 | 3300018481 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVAYWQAVDRFTRG |
| Ga0190271_122986581 | 3300018481 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASAAGARTLGVTYWQAVDRFTRGGVRASW |
| Ga0247788_10755742 | 3300022901 | Soil | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTL |
| Ga0207642_105258932 | 3300025899 | Miscanthus Rhizosphere | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVRASW |
| Ga0207645_110145632 | 3300025907 | Miscanthus Rhizosphere | VSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRLTRGAVRASWTGD |
| Ga0207643_111424051 | 3300025908 | Miscanthus Rhizosphere | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGG |
| Ga0207707_101949091 | 3300025912 | Corn Rhizosphere | VSGWETSERVLESGRFESRQRVLVAEPVVEASEAGARSLGVTY |
| Ga0207695_110019241 | 3300025913 | Corn Rhizosphere | MAAIDWETSERVLESGGFESRQRVLVAQPAVEASESGARTLGIV |
| Ga0207660_110547802 | 3300025917 | Corn Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQA |
| Ga0207650_114891152 | 3300025925 | Switchgrass Rhizosphere | VTGWETSERVLESGGFESRQRVLVPEPVVEASEAGARTLGVTYWQAVDR |
| Ga0207659_114219891 | 3300025926 | Miscanthus Rhizosphere | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVR |
| Ga0207687_105742331 | 3300025927 | Miscanthus Rhizosphere | MTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVRA |
| Ga0207686_100815685 | 3300025934 | Miscanthus Rhizosphere | VTGWETSERVLESGAFESRQRALVAEPAVEASEAGARTLGVTYW |
| Ga0207686_117484192 | 3300025934 | Miscanthus Rhizosphere | VTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFTRGGVRASWTGDGG |
| Ga0207709_106170331 | 3300025935 | Miscanthus Rhizosphere | MTMAAGTGWETSERVLESGGFESRQRVLVTEPVVEASESGARTLGVTYWQSVDGFT |
| Ga0207691_1000913610 | 3300025940 | Miscanthus Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDGFTRGGI |
| Ga0207677_107800461 | 3300026023 | Miscanthus Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDGFTRGGIRAS |
| Ga0207703_116576411 | 3300026035 | Switchgrass Rhizosphere | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGAR |
| Ga0207676_108846181 | 3300026095 | Switchgrass Rhizosphere | VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY |
| Ga0268266_104447322 | 3300028379 | Switchgrass Rhizosphere | VTGWETSERVLESGGFESRQRVLVPEPVVEASEAGARTLGVTYWQAVEQLQVPP |
| Ga0247821_104632511 | 3300028596 | Soil | MTGWETTERLLDSGGFESRQSVLVPEPVVEASEAGARTLGVTYWHAVDRFTRGGVRASWK |
| Ga0247820_109584091 | 3300028597 | Soil | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRLT |
| Ga0247826_104737731 | 3300030336 | Soil | MTGWETTERLLDSGGFESRQSVLVPEPVVEASEAGARTLGVTYWQAVDRFTRG |
| Ga0310904_103768162 | 3300031854 | Soil | VTGWETSERVCESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTR |
| Ga0310900_104584391 | 3300031908 | Soil | VTGWETSERVLESGGFESRQRVLVPEPIVEASEAGARTLGVTYWQAV |
| Ga0310900_110483492 | 3300031908 | Soil | MTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYW |
| Ga0308175_1002666094 | 3300031938 | Soil | VTGWETSERVLESGGFESRQRVLVGEPVVEASEAGARTLGVAYWQAVDRFTRGLVRAS |
| Ga0308174_108983451 | 3300031939 | Soil | MTGWETSERVLESGAFESRQRVLVAEPVVEASVAGARSLGVTYWLAVDR |
| Ga0308176_118341733 | 3300031996 | Soil | MAVYGVTGWETSERVFESGGFESRQRVLVAKPLVEASEAGARTLGVTYWQAVDR |
| Ga0335085_121341032 | 3300032770 | Soil | VTGWETSERVLESGAFESRQQVLAPEPAVEASEAGARTLGITYWQAVDRFTRG |
| Ga0335082_101178651 | 3300032782 | Soil | VTGWESSERVLESGDFESRQRILVAEPAVEVSEAGARTLGITYWQAVDRFTRGGVR |
| Ga0310811_110966432 | 3300033475 | Soil | MAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGVRASW |
| Ga0247829_101115381 | 3300033550 | Soil | MVVDGVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRASSPPW |
| ⦗Top⦘ |