| Basic Information | |
|---|---|
| Family ID | F095838 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPP |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.52 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.048 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01370 | Epimerase | 19.05 |
| PF14246 | TetR_C_7 | 17.14 |
| PF13302 | Acetyltransf_3 | 8.57 |
| PF13738 | Pyr_redox_3 | 6.67 |
| PF13377 | Peripla_BP_3 | 5.71 |
| PF13450 | NAD_binding_8 | 2.86 |
| PF00149 | Metallophos | 1.90 |
| PF12727 | PBP_like | 1.90 |
| PF00753 | Lactamase_B | 1.90 |
| PF00561 | Abhydrolase_1 | 0.95 |
| PF00274 | Glycolytic | 0.95 |
| PF12833 | HTH_18 | 0.95 |
| PF12697 | Abhydrolase_6 | 0.95 |
| PF12681 | Glyoxalase_2 | 0.95 |
| PF13560 | HTH_31 | 0.95 |
| PF03631 | Virul_fac_BrkB | 0.95 |
| PF01832 | Glucosaminidase | 0.95 |
| PF09037 | Sulphotransf | 0.95 |
| PF01636 | APH | 0.95 |
| PF00488 | MutS_V | 0.95 |
| PF12802 | MarR_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.95 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.95 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.95 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.95 |
| COG4424 | LPS sulfotransferase NodH | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.38 % |
| Unclassified | root | N/A | 27.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01AYJG0 | Not Available | 524 | Open in IMG/M |
| 3300000956|JGI10216J12902_121578883 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005329|Ga0070683_100453672 | Not Available | 1223 | Open in IMG/M |
| 3300005338|Ga0068868_101316312 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005435|Ga0070714_102136820 | Not Available | 545 | Open in IMG/M |
| 3300005436|Ga0070713_102175104 | Not Available | 537 | Open in IMG/M |
| 3300005437|Ga0070710_10849302 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005439|Ga0070711_100261571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → unclassified Actinophytocola → Actinophytocola sp. | 1361 | Open in IMG/M |
| 3300005445|Ga0070708_100263657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1620 | Open in IMG/M |
| 3300005544|Ga0070686_100254375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1284 | Open in IMG/M |
| 3300005548|Ga0070665_100145801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2370 | Open in IMG/M |
| 3300005578|Ga0068854_100160305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1741 | Open in IMG/M |
| 3300005614|Ga0068856_100399417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1394 | Open in IMG/M |
| 3300005616|Ga0068852_100521596 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300005718|Ga0068866_10484220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300005842|Ga0068858_100205708 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300006028|Ga0070717_10745305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300006175|Ga0070712_101359355 | Not Available | 619 | Open in IMG/M |
| 3300006573|Ga0074055_11871355 | Not Available | 1037 | Open in IMG/M |
| 3300006797|Ga0066659_10380495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1104 | Open in IMG/M |
| 3300006800|Ga0066660_10366156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1177 | Open in IMG/M |
| 3300006854|Ga0075425_102782886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 538 | Open in IMG/M |
| 3300006881|Ga0068865_101262868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300006904|Ga0075424_100745491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1045 | Open in IMG/M |
| 3300006904|Ga0075424_101676090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300006954|Ga0079219_11172425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300009098|Ga0105245_12610237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300009143|Ga0099792_10489620 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009162|Ga0075423_13013000 | Not Available | 516 | Open in IMG/M |
| 3300009545|Ga0105237_10711023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1011 | Open in IMG/M |
| 3300009551|Ga0105238_12449166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300010046|Ga0126384_10144293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Oryzihumus → Oryzihumus leptocrescens | 1824 | Open in IMG/M |
| 3300010046|Ga0126384_11254896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300010048|Ga0126373_11192702 | Not Available | 827 | Open in IMG/M |
| 3300010375|Ga0105239_10377375 | Not Available | 1603 | Open in IMG/M |
| 3300010399|Ga0134127_12207454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → Catellatospora tritici | 630 | Open in IMG/M |
| 3300010400|Ga0134122_11328500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
| 3300010401|Ga0134121_11119623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300012201|Ga0137365_10229085 | Not Available | 1385 | Open in IMG/M |
| 3300012201|Ga0137365_10842709 | Not Available | 669 | Open in IMG/M |
| 3300012210|Ga0137378_10481226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1148 | Open in IMG/M |
| 3300012356|Ga0137371_10406106 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300012359|Ga0137385_10451955 | Not Available | 1091 | Open in IMG/M |
| 3300012359|Ga0137385_10896719 | Not Available | 734 | Open in IMG/M |
| 3300012984|Ga0164309_10499727 | Not Available | 931 | Open in IMG/M |
| 3300013104|Ga0157370_11619009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 582 | Open in IMG/M |
| 3300013105|Ga0157369_10353978 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300013296|Ga0157374_12573978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300013297|Ga0157378_10339498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1464 | Open in IMG/M |
| 3300013297|Ga0157378_12178977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300013307|Ga0157372_11866475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300014745|Ga0157377_10381451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
| 3300014969|Ga0157376_11430912 | Not Available | 723 | Open in IMG/M |
| 3300015242|Ga0137412_10159930 | Not Available | 1814 | Open in IMG/M |
| 3300015264|Ga0137403_10603137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300015372|Ga0132256_100681412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
| 3300016341|Ga0182035_10300727 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300017947|Ga0187785_10535708 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300020082|Ga0206353_11058841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1905 | Open in IMG/M |
| 3300021171|Ga0210405_10364527 | Not Available | 1139 | Open in IMG/M |
| 3300021432|Ga0210384_10654736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 941 | Open in IMG/M |
| 3300021479|Ga0210410_10861779 | Not Available | 792 | Open in IMG/M |
| 3300021559|Ga0210409_10922587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300021559|Ga0210409_11679550 | Not Available | 511 | Open in IMG/M |
| 3300024288|Ga0179589_10530642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300025898|Ga0207692_10148901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
| 3300025898|Ga0207692_10633173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium amethystogenes | 690 | Open in IMG/M |
| 3300025899|Ga0207642_10011401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3170 | Open in IMG/M |
| 3300025900|Ga0207710_10134941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300025904|Ga0207647_10160566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1311 | Open in IMG/M |
| 3300025904|Ga0207647_10809279 | Not Available | 503 | Open in IMG/M |
| 3300025911|Ga0207654_10885594 | Not Available | 647 | Open in IMG/M |
| 3300025918|Ga0207662_10487623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300025922|Ga0207646_10660402 | Not Available | 936 | Open in IMG/M |
| 3300025927|Ga0207687_10165358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1702 | Open in IMG/M |
| 3300025928|Ga0207700_10201819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
| 3300025929|Ga0207664_11091678 | Not Available | 713 | Open in IMG/M |
| 3300025934|Ga0207686_10391474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 1056 | Open in IMG/M |
| 3300026035|Ga0207703_12329732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300026078|Ga0207702_10288016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1555 | Open in IMG/M |
| 3300026490|Ga0257153_1075689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 678 | Open in IMG/M |
| 3300026911|Ga0209620_1011857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300027787|Ga0209074_10081250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300027817|Ga0209112_10033351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1532 | Open in IMG/M |
| 3300027903|Ga0209488_10209234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1469 | Open in IMG/M |
| 3300028536|Ga0137415_10263990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1529 | Open in IMG/M |
| 3300028718|Ga0307307_10023844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300028768|Ga0307280_10004884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3459 | Open in IMG/M |
| 3300028784|Ga0307282_10325207 | Not Available | 742 | Open in IMG/M |
| 3300028787|Ga0307323_10080425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
| 3300028793|Ga0307299_10393722 | Not Available | 519 | Open in IMG/M |
| 3300028828|Ga0307312_10573553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium amethystogenes | 746 | Open in IMG/M |
| 3300028828|Ga0307312_10962025 | Not Available | 566 | Open in IMG/M |
| 3300031199|Ga0307495_10064134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300031754|Ga0307475_10723714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300031765|Ga0318554_10225442 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300031771|Ga0318546_10586496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300031793|Ga0318548_10276947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300032066|Ga0318514_10202936 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300032205|Ga0307472_100126820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1817 | Open in IMG/M |
| 3300032205|Ga0307472_102606110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → unclassified Streptosporangium → Streptosporangium sp. 'caverna' | 515 | Open in IMG/M |
| 3300032898|Ga0335072_10910257 | Not Available | 822 | Open in IMG/M |
| 3300032954|Ga0335083_10944540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300032955|Ga0335076_10532697 | Not Available | 1057 | Open in IMG/M |
| 3300033158|Ga0335077_11575727 | Not Available | 626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_00875980 | 2170459024 | Grass Soil | MPPEPVPADPGWDEDLAWLDRDPERESWLDRARERDEPPLEEEY |
| JGI10216J12902_1215788831 | 3300000956 | Soil | MPNGWWYMLPEPVPADPRRDDDLAWLDRDPEREDWLNRVCE |
| Ga0070683_1004536721 | 3300005329 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPLDE |
| Ga0068868_1013163121 | 3300005338 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDPAWLDRDPERESWLDRAREHDDSPL |
| Ga0070714_1021368201 | 3300005435 | Agricultural Soil | MLPSPVPADAGWDEDLAWLDRDPEREVWLARAREHDEPPGEDEEF |
| Ga0070713_1021751041 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPVPADAGWDEDLAWLDRDPEREVWLARAREHDEPPGED |
| Ga0070710_108493023 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPASPASADPGWDEDLAWLDRDPELETWLDRAREYDEPPLEEEYEDYE |
| Ga0070711_1002615713 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVSADPGWDEDLAWLDRDPERETWLDRAREHDAPPEPEESGGFPE |
| Ga0070708_1002636571 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFMPPSPVPADPGRDEDLAWLDRDPEREDWLDRAREHDEPPG |
| Ga0070686_1002543752 | 3300005544 | Switchgrass Rhizosphere | MPPEPVPADPGWDGDLAWLDRDPERETWLDRAREHEDPPLEEEYE |
| Ga0070665_1001458014 | 3300005548 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDPPLDE |
| Ga0068854_1001603051 | 3300005578 | Corn Rhizosphere | MFYRNHQPNGWWYMPPEPVPADPGWDGDLAWLDRDPERETWLDRAREHDDPPLDEP |
| Ga0068856_1003994171 | 3300005614 | Corn Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDEPPLDEE |
| Ga0068852_1005215963 | 3300005616 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDP |
| Ga0068866_104842201 | 3300005718 | Miscanthus Rhizosphere | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPLDE |
| Ga0068858_1002057081 | 3300005842 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPP |
| Ga0070717_107453051 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDE |
| Ga0070712_1013593553 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPSPVPADPGWDEDLAWLDRDPEREHWLARAREH |
| Ga0074055_118713551 | 3300006573 | Soil | MLLSPVPADPGPGDLAWLDRDPERECWLDRAREHDEPPEPEE |
| Ga0066659_103804952 | 3300006797 | Soil | MPPSPVPADPGWDEDLAWLDRDPEREVWLARAREHDE |
| Ga0066660_103661561 | 3300006800 | Soil | MPPEPVSADPGWDEDLTWLDRDPERQTWLDRAREHDDPPEPEE |
| Ga0075425_1027828862 | 3300006854 | Populus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDE |
| Ga0068865_1012628682 | 3300006881 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDEPPLDEEY |
| Ga0075424_1007454912 | 3300006904 | Populus Rhizosphere | MMPNGWWSMLPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDE |
| Ga0075424_1016760902 | 3300006904 | Populus Rhizosphere | MPAEPVPADPGWDEDLAWLDRDPERETWLDRAREHD |
| Ga0079219_111724252 | 3300006954 | Agricultural Soil | MPQEPVPADPGWDEDLAWLDRDPERETWLDRAREHD |
| Ga0105245_126102371 | 3300009098 | Miscanthus Rhizosphere | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPL |
| Ga0099792_104896202 | 3300009143 | Vadose Zone Soil | MPPEPAPADPGWDEDLAWLDRDPERETWLDRAREHDDSPLEVEYADY |
| Ga0075423_130130002 | 3300009162 | Populus Rhizosphere | MPPEPVPAEPGWDEDLAWLDRDPEREVWLDRALELDDPPEPEESGGFPELTPD |
| Ga0105237_107110231 | 3300009545 | Corn Rhizosphere | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPERETWLDRARE |
| Ga0105238_124491662 | 3300009551 | Corn Rhizosphere | MWFMPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPP |
| Ga0126384_101442931 | 3300010046 | Tropical Forest Soil | MPQQPVPADPGWDDDLAWLDRDPERDCWLDRAREHDEPSGPE |
| Ga0126384_112548962 | 3300010046 | Tropical Forest Soil | MPPEPVPADPGWDEDLAWLDRDPERETWRDRAREHDEPALEEEY |
| Ga0126373_111927022 | 3300010048 | Tropical Forest Soil | MPQQPVPADPGPEEDLAWLDRDPEREVWLDRARDHDEPPEP |
| Ga0105239_103773751 | 3300010375 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPRWTRNTRT |
| Ga0134127_122074542 | 3300010399 | Terrestrial Soil | MSLPPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGDDEDYGNFE |
| Ga0134122_113285002 | 3300010400 | Terrestrial Soil | MPSEPVPADPGWDEDLAWLDRDPERETWLDRAREHDE |
| Ga0134121_111196232 | 3300010401 | Terrestrial Soil | MFYRNHQPNGWWYMPPEPVPADPGWDGDLAWLDRDPERETWLDRAREHEDPPLEEEYEDY |
| Ga0137365_102290851 | 3300012201 | Vadose Zone Soil | MPPEPVPADPGWDEDLAWLDRDPERESWLDRAREHDEPPLEEE |
| Ga0137365_108427091 | 3300012201 | Vadose Zone Soil | MPAEPVPADPGWDEDLAWLDRDPERESWLDRAREHDEPPLEEE |
| Ga0137378_104812262 | 3300012210 | Vadose Zone Soil | MPPEPVPADPGWDEDLAWLDRDPERESWLDRAREH |
| Ga0137371_104061062 | 3300012356 | Vadose Zone Soil | MSLPPVPAGPGWDEDLTWLDRDPEREVWLARAREHDEPP |
| Ga0137385_104519552 | 3300012359 | Vadose Zone Soil | MPPEPVPADPGWDEDLAWLDRDPERESWLDRAREHDEPPLEEEY |
| Ga0137385_108967191 | 3300012359 | Vadose Zone Soil | MPAEPVPADPGWDEDLAWLDRDPERESWLDRAREHDEPPL |
| Ga0164309_104997271 | 3300012984 | Soil | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDD |
| Ga0157370_116190091 | 3300013104 | Corn Rhizosphere | MPPEPVPADPGWDDDLAWLDRDPERETWLDRAREHDDP |
| Ga0157369_103539784 | 3300013105 | Corn Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREH |
| Ga0157374_125739782 | 3300013296 | Miscanthus Rhizosphere | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHD |
| Ga0157378_103394981 | 3300013297 | Miscanthus Rhizosphere | MFYRNHQPNGWWYMPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPL |
| Ga0157378_121789772 | 3300013297 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPL |
| Ga0157372_118664752 | 3300013307 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDPPLEEEY |
| Ga0157377_103814511 | 3300014745 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLTWLDGDPERETWLDRAREHDEPPL |
| Ga0157376_114309122 | 3300014969 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPMTAQEREELLDR |
| Ga0137412_101599303 | 3300015242 | Vadose Zone Soil | MPVSPVPADPRPDDLAWLDRDPERECWLDRAREHDEPPES |
| Ga0137403_106031371 | 3300015264 | Vadose Zone Soil | MLPSPVPADPGWDEDLTWLDRDPEREDWLDRAREHDEPVVEDEEYE |
| Ga0132256_1006814121 | 3300015372 | Arabidopsis Rhizosphere | MPAEPVPADPGWDENLAWLDRDPERESWLDRAREHDEPPQEE |
| Ga0182035_103007271 | 3300016341 | Soil | MSSEPVPADPGWDDDLTWLDRDPATPAEREAWLDR |
| Ga0187785_105357082 | 3300017947 | Tropical Peatland | MPPEPVPADSGWDDDLTWLDRDPATPAERAAWLDRVCEQD |
| Ga0206353_110588411 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDEPPLDE |
| Ga0210405_103645271 | 3300021171 | Soil | MPPSPVPADPGWDEDLAWLDRDPEREHWLARAREHDEPPGEDEE |
| Ga0210384_106547361 | 3300021432 | Soil | MPPEPVPADPGWDEDLAWLDRDPVTAAGREAWLDWLCEQDDDSFDAPQ |
| Ga0210410_108617791 | 3300021479 | Soil | MLPSPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGEDEDDGHFEP |
| Ga0210409_109225871 | 3300021559 | Soil | MPPSPVPADPGWDEDLAWLDRDPEREHWLARAREHDEPPGEEEDY |
| Ga0210409_116795502 | 3300021559 | Soil | MPPSPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGE |
| Ga0179589_105306422 | 3300024288 | Vadose Zone Soil | MLVMAAMPDPAGPGWGEDLAWLDRDPEREHWLDRAREHDEPGPEE |
| Ga0207692_101489012 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPSPVPADPGWNEDLAWLDRDPEREDWLARAREHDDPPGED |
| Ga0207692_106331732 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPSPVPADAGWDEDLAWLDRDPEREVWLARAREHDEPP |
| Ga0207642_100114011 | 3300025899 | Miscanthus Rhizosphere | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPERECWLDR |
| Ga0207710_101349412 | 3300025900 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHGEPPLE |
| Ga0207647_101605661 | 3300025904 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDPPL |
| Ga0207647_108092792 | 3300025904 | Corn Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDEP |
| Ga0207654_108855941 | 3300025911 | Corn Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDEPPLDEEY |
| Ga0207662_104876232 | 3300025918 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPEREIWLDRAREHDE |
| Ga0207646_106604023 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREH |
| Ga0207687_101653583 | 3300025927 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHD |
| Ga0207700_102018191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHD |
| Ga0207664_110916783 | 3300025929 | Agricultural Soil | MPASPASADPGWDEDLAWLDRDPERDCWLDRAREHD |
| Ga0207686_103914741 | 3300025934 | Miscanthus Rhizosphere | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDSPL |
| Ga0207703_123297322 | 3300026035 | Switchgrass Rhizosphere | MPPEPVPADPGWDEDLTWLDRDPERETWLDRAREHDEPPLDEEYADH |
| Ga0207702_102880161 | 3300026078 | Corn Rhizosphere | MFYRNHQPNGWWYMPPEPVPADPGWDGDLAWLDRDPERETWLDRAREHEDP |
| Ga0257153_10756891 | 3300026490 | Soil | MPPEPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGEDEDD |
| Ga0209620_10118571 | 3300026911 | Forest Soil | MFYRNHQPNGWWYMPPEPLPADPGWDGDLAWLDRDPERETWLDRAREHEDPPLEEEY |
| Ga0209074_100812501 | 3300027787 | Agricultural Soil | MPPEPVPADPGWDEDLAWLDRDPERETWLDRACEHDEPPDL |
| Ga0209112_100333511 | 3300027817 | Forest Soil | MPPEPVPADPGWDDLAWLDRDPERETWLDRAREHDEPPLDE |
| Ga0209488_102092343 | 3300027903 | Vadose Zone Soil | MPNGWWYMPPEPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGEDE |
| Ga0137415_102639903 | 3300028536 | Vadose Zone Soil | MLPEPVSADPRWDEDLAWLDRDPERETWLARAREHDDPPEPEE |
| Ga0307307_100238441 | 3300028718 | Soil | MPNGWWYMPPEPVPADPGWDEDLTWLDRDPERESWLDRAREHDE |
| Ga0307280_100048841 | 3300028768 | Soil | MPPEPVPADPGWDEDLTWLDRDPERDTWLDRACEHDDP |
| Ga0307282_103252072 | 3300028784 | Soil | MPPSPVPADPGWDEDLTWLDRDPERETWLNSAREHDDPPGPEESGGFPGLTPD |
| Ga0307323_100804252 | 3300028787 | Soil | MPPEPVPADPGWDEDLTWLDRDPERESWLDRAREH |
| Ga0307299_103937221 | 3300028793 | Soil | MLPSPVPTDPGWDEDLTWLDRDPEREEWLARAREH |
| Ga0307312_105735531 | 3300028828 | Soil | MPPEPVPADPGWDEDLAWLDRDPERESWLDRASEHDEPPEPEE |
| Ga0307312_109620252 | 3300028828 | Soil | MPPSPVPADPGWDEDLTWLDRDPERETWLNSAREHDDPPGPEESGGF |
| Ga0307495_100641342 | 3300031199 | Soil | MPPEPVPADPGWDEDLTWLDRDPERQTWLDRAREHD |
| Ga0307475_107237142 | 3300031754 | Hardwood Forest Soil | MPPSPVPADPGWDEDLAWLDRDPEREVWLARAREHDEPPGEDEDDGHFE |
| Ga0318554_102254421 | 3300031765 | Soil | MSSEPVPADPGWDDDLTWLDRDPATPAEREAWLDRVCEFDEPPEPEEY |
| Ga0318546_105864961 | 3300031771 | Soil | MPPEPVPADPGWDDDLTWLDRDPATPAERAEWLDRVAEADDPPEEEEY |
| Ga0318548_102769472 | 3300031793 | Soil | MPPEPVPADPGWDDDLTWLDRDPATPAEREAWLDRVCEFDEPPEP |
| Ga0318514_102029361 | 3300032066 | Soil | MPPEPVPADPGPDKDLAWLDRDPEREVWLDRARGHDEPPEPAEEEYED |
| Ga0307472_1001268203 | 3300032205 | Hardwood Forest Soil | MPPEPVPADPGPDEDLAWLDRDPEREVWLDRARDDDEPPEP |
| Ga0307472_1026061102 | 3300032205 | Hardwood Forest Soil | MPPEPVPADPGWDEDLAWLDRDPERETWLDRAREHDDSPLEVEYADD |
| Ga0335072_109102572 | 3300032898 | Soil | MPPEPVPADPGWDEDLTWLDRDPERETWLGRAREHDEPPLEEE |
| Ga0335083_109445401 | 3300032954 | Soil | MPASPASADPGPDDLAWLDRDPERDCWLDRAREHDEPPLEEEYEDH |
| Ga0335076_105326972 | 3300032955 | Soil | MPPEPVPADPGRDEDLAWLDRDPEREVWLDRARDHDEPP |
| Ga0335077_115757271 | 3300033158 | Soil | MPPESVSADPGWDEDLTWLDRDPEREHWLARAREHDEPPGQEEEWEDFE |
| ⦗Top⦘ |