NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095817

Metagenome / Metatranscriptome Family F095817

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095817
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 111 residues
Representative Sequence MAENDLLEAVELERTADWRIKKLGENPSDRDSAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Number of Associated Samples 77
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.29 %
% of genes near scaffold ends (potentially truncated) 37.14 %
% of genes from short scaffolds (< 2000 bps) 73.33 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.81

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.095 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.952 % of family members)
Environment Ontology (ENVO) Unclassified
(27.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.095 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.43%    β-sheet: 0.00%    Coil/Unstructured: 38.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.81
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.48.1.0: automated matchesd3vrna13vrn0.53644
a.25.1.1: Ferritind1vjxa11vjx0.52669
d.92.1.0: automated matchesd6g8ua_6g8u0.52165
d.2.1.1: Family 19 glycosidased2z39a12z390.52158
f.55.1.1: Photosystem II antenna protein-liked5b5eb_5b5e0.52114


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF02515CoA_transf_3 36.19
PF01212Beta_elim_lyase 21.90
PF00355Rieske 3.81
PF02668TauD 2.86
PF03328HpcH_HpaI 1.90
PF04909Amidohydro_2 1.90
PF00561Abhydrolase_1 0.95
PF03466LysR_substrate 0.95
PF00378ECH_1 0.95
PF02586SRAP 0.95
PF01728FtsJ 0.95
PF00296Bac_luciferase 0.95
PF07045DUF1330 0.95
PF01070FMN_dh 0.95
PF01144CoA_trans 0.95
PF00501AMP-binding 0.95
PF13545HTH_Crp_2 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 43.81
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 36.19
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 21.90
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 21.90
COG3033TryptophanaseAmino acid transport and metabolism [E] 21.90
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 21.90
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 21.90
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 21.90
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 21.90
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 21.90
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 21.90
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 21.90
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 21.90
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 21.90
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 21.90
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 21.90
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 21.90
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 21.90
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 2.86
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 1.90
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 1.90
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 1.90
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.95
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.95
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.95
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.95
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.95
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.95
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.95
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.95
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.95
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.10 %
UnclassifiedrootN/A1.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000574|JGI1357J11328_10011338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5006Open in IMG/M
3300001471|JGI12712J15308_10141739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11619Open in IMG/M
3300004091|Ga0062387_100917766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11664Open in IMG/M
3300004092|Ga0062389_102483504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11687Open in IMG/M
3300004635|Ga0062388_101027387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11803Open in IMG/M
3300005458|Ga0070681_10833537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11840Open in IMG/M
3300005534|Ga0070735_10033239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3555Open in IMG/M
3300005534|Ga0070735_10222173All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300005538|Ga0070731_10183143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1391Open in IMG/M
3300005541|Ga0070733_10089983All Organisms → cellular organisms → Bacteria1950Open in IMG/M
3300005541|Ga0070733_10639250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11714Open in IMG/M
3300005542|Ga0070732_10160913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111338Open in IMG/M
3300005547|Ga0070693_100946240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11648Open in IMG/M
3300006176|Ga0070765_100067247All Organisms → cellular organisms → Bacteria → Proteobacteria2992Open in IMG/M
3300006176|Ga0070765_100628837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111013Open in IMG/M
3300009093|Ga0105240_10860275All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300010048|Ga0126373_12544940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11570Open in IMG/M
3300010048|Ga0126373_12551246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11570Open in IMG/M
3300010371|Ga0134125_11433334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales752Open in IMG/M
3300010376|Ga0126381_100044085All Organisms → cellular organisms → Bacteria → Proteobacteria5423Open in IMG/M
3300010396|Ga0134126_10186920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2488Open in IMG/M
3300013832|Ga0120132_1076287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11679Open in IMG/M
3300014156|Ga0181518_10225143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11964Open in IMG/M
3300014159|Ga0181530_10003067All Organisms → cellular organisms → Bacteria → Proteobacteria19036Open in IMG/M
3300014200|Ga0181526_10861071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11570Open in IMG/M
3300014201|Ga0181537_10002215All Organisms → cellular organisms → Bacteria → Proteobacteria17250Open in IMG/M
3300014495|Ga0182015_10015706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales6449Open in IMG/M
3300014501|Ga0182024_10009335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria20319Open in IMG/M
3300014501|Ga0182024_10012980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria16386Open in IMG/M
3300014501|Ga0182024_11583903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11743Open in IMG/M
3300014654|Ga0181525_10181650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111151Open in IMG/M
3300014657|Ga0181522_10448788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11774Open in IMG/M
3300017930|Ga0187825_10361392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11551Open in IMG/M
3300017961|Ga0187778_11005552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11577Open in IMG/M
3300017973|Ga0187780_10757592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11702Open in IMG/M
3300017995|Ga0187816_10454329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11573Open in IMG/M
3300018042|Ga0187871_10356308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11808Open in IMG/M
3300018062|Ga0187784_10268123All Organisms → cellular organisms → Bacteria → Proteobacteria1388Open in IMG/M
3300018088|Ga0187771_10050903All Organisms → cellular organisms → Bacteria → Proteobacteria3227Open in IMG/M
3300018088|Ga0187771_11461877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11580Open in IMG/M
3300020579|Ga0210407_10913422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11673Open in IMG/M
3300020581|Ga0210399_10398201All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300020583|Ga0210401_11142825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11637Open in IMG/M
3300021180|Ga0210396_11123687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11661Open in IMG/M
3300021181|Ga0210388_10107145All Organisms → cellular organisms → Bacteria → Proteobacteria2398Open in IMG/M
3300021181|Ga0210388_10293441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1428Open in IMG/M
3300021181|Ga0210388_11177261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11651Open in IMG/M
3300021401|Ga0210393_10041247All Organisms → cellular organisms → Bacteria3623Open in IMG/M
3300021401|Ga0210393_10122464All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300021401|Ga0210393_10372785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1163Open in IMG/M
3300021402|Ga0210385_11167603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11591Open in IMG/M
3300021407|Ga0210383_10083066All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300021407|Ga0210383_11031073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11697Open in IMG/M
3300021420|Ga0210394_11319845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11616Open in IMG/M
3300021433|Ga0210391_10846510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11714Open in IMG/M
3300021477|Ga0210398_10336291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111232Open in IMG/M
3300021477|Ga0210398_10562971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11927Open in IMG/M
3300021477|Ga0210398_11071919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11641Open in IMG/M
3300021479|Ga0210410_10833582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11808Open in IMG/M
3300021559|Ga0210409_10213131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111756Open in IMG/M
3300025913|Ga0207695_10736534All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300027545|Ga0209008_1096501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11661Open in IMG/M
3300027815|Ga0209726_10000752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria58179Open in IMG/M
3300027867|Ga0209167_10048080All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300027895|Ga0209624_10035937All Organisms → cellular organisms → Bacteria3155Open in IMG/M
3300027908|Ga0209006_10001083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria24966Open in IMG/M
3300027908|Ga0209006_10437608Not Available1097Open in IMG/M
3300027986|Ga0209168_10137579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111243Open in IMG/M
3300027986|Ga0209168_10156693All Organisms → cellular organisms → Bacteria → Proteobacteria1152Open in IMG/M
3300028781|Ga0302223_10226440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11617Open in IMG/M
3300028800|Ga0265338_10874386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11613Open in IMG/M
3300028906|Ga0308309_10035104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3484Open in IMG/M
3300029636|Ga0222749_10478023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11671Open in IMG/M
3300029943|Ga0311340_10089474All Organisms → cellular organisms → Bacteria3438Open in IMG/M
3300029951|Ga0311371_12168552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11581Open in IMG/M
3300029999|Ga0311339_10364369All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300030007|Ga0311338_10068314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4599Open in IMG/M
3300030524|Ga0311357_10128795All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300030618|Ga0311354_10620645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111047Open in IMG/M
3300030998|Ga0073996_12277048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11831Open in IMG/M
3300031231|Ga0170824_126588435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11681Open in IMG/M
3300031234|Ga0302325_11364326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11926Open in IMG/M
3300031234|Ga0302325_12135327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11684Open in IMG/M
3300031236|Ga0302324_100161026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3657Open in IMG/M
3300031236|Ga0302324_100908459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111210Open in IMG/M
3300031446|Ga0170820_12788758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11707Open in IMG/M
3300031708|Ga0310686_102679127All Organisms → cellular organisms → Bacteria2505Open in IMG/M
3300031708|Ga0310686_118558151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11769Open in IMG/M
3300031715|Ga0307476_10157235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1636Open in IMG/M
3300032783|Ga0335079_10521653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111264Open in IMG/M
3300032783|Ga0335079_12303477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11511Open in IMG/M
3300032805|Ga0335078_10504566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111554Open in IMG/M
3300032805|Ga0335078_11127798All Organisms → cellular organisms → Bacteria → Proteobacteria914Open in IMG/M
3300032805|Ga0335078_12259348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11571Open in IMG/M
3300032892|Ga0335081_10176292Not Available3004Open in IMG/M
3300032892|Ga0335081_11495216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11748Open in IMG/M
3300032895|Ga0335074_10106068All Organisms → cellular organisms → Bacteria3685Open in IMG/M
3300032895|Ga0335074_10838948All Organisms → cellular organisms → Bacteria → Proteobacteria848Open in IMG/M
3300032896|Ga0335075_10128952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-113220Open in IMG/M
3300032896|Ga0335075_11613361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11533Open in IMG/M
3300032955|Ga0335076_10282856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111550Open in IMG/M
3300033134|Ga0335073_10339986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-111783Open in IMG/M
3300033134|Ga0335073_10755831All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300033134|Ga0335073_11203067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11760Open in IMG/M
3300033134|Ga0335073_11694265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11597Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil15.24%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.48%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil8.57%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.86%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.90%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1357J11328_1001133863300000574GroundwaterMPADDPVEVVELERVADWRIKKLGENPSDTDSAGAAKLLQKLADDLRGLAGSPVYAEYRAICGWLDEYQGIEDFAERAHEYRTRIGIDRFPADGEEYLRILTGFAKETFGA*
JGI12712J15308_1014173923300001471Forest SoilMAEDDPLEASELERIADWRIRKLGENPADAESAAAAKLLQKLADDLRTLTGSPTYNEYQAICSWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP*
Ga0062387_10091776623300004091Bog Forest SoilMNDADLPEVIELERAADWRIRKLGENPGDAESAAAARLLQTLADELRGLTGSAAYQEYQAICGWLDEFDGMAELAEYAQDYRVRIGVDHLPASGEEYLRVLIGFAKETFGSP*
Ga0062389_10248350423300004092Bog Forest SoilPEAIELERTADWRIRKLGENPDDAESDAAAILLQKLADDLRALTGSPAYREYQAICGWLDEFDGMAELAEYAQDYRLRIGADKFPANGEAYLRVLLGFARDTFGSP*
Ga0062388_10102738713300004635Bog Forest SoilMNDADLPEVIELERAADWRIRKLGENPGDAESAAAARLLQTLADELRGLTGSAAYQEYQAICGWLDEFDGMAELAEYAQDYRVRIGVDHLPASGEEYLRVLIGFAKETFGSP
Ga0070681_1083353713300005458Corn RhizosphereMGAPSSDLLEAIELERTADWRIKKLGENPSDKESETAAKLLQSLADDLRALRLSPVYKEYQAICGWLDEFDGMAELSEYAHDYRVRIGVDRFPADGEEYLR
Ga0070735_1003323923300005534Surface SoilMSRPSENDLPEAVELERAADWRISKLGGNPDDAESAAAARLLQQLADEVRSLAGSPTYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDKFPANGEDYLKVLIGFAKETFGAP*
Ga0070735_1022217323300005534Surface SoilVSDPDIPEAVELEQAADWRIKRLGADPSDRQSETAAKLLQKLADDLRVLVGSPLYREYQAICGWLDEFDGMAELAEYGHDYRARIGIDKFPADGAEYLRVLIGFARDAFGAP*
Ga0070731_1018314323300005538Surface SoilVSDPDIPEAVELEQAADWRIKRLGADPSDRQSETAAKLLQKLADDLRVLVGSPLYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDKFPANGEDYLKVLIGFAKETFGAP*
Ga0070733_1008998333300005541Surface SoilPERARPRRVGKAVSDPDIPEAVELEQAADWRIKRLGADPSDRQSETAAKLLQKLADDLRVLVGSPLYREYQAICGWLDEFDGMAELAEYAHDYRARIGIDKFPADGAEYLRVLIGFARDAFGAP*
Ga0070733_1063925013300005541Surface SoilMAEDPLEAVELERTADWRIKKLGENPDDRQSAEAAKLSQKLADDVRGLTGSAAYKEYQAICGWLDEFDGMAELSEYARDYRARIGIDKFPVDGEEYLHVLIGFAKETFGAP*
Ga0070732_1016091323300005542Surface SoilMMAEDPHEAVELDRTADWRIKKLGEDPADQQSAEAAKLLHKLADEVRGMTGSPAYKEYQAICGWLDEFDGMAELQEYAQDYRARIGIDKFPVDGEEYLHVLIGFAKETFGAP*
Ga0070693_10094624013300005547Corn, Switchgrass And Miscanthus RhizosphereLGENPSDKESETAAKLLQSLADDLRALRLSPVYKEYQAICGWLDEFDGMAELSEYAHDYRVRIGVDRFPADGEEYLRVLIGFAKDTFGSP*
Ga0070765_10006724713300006176SoilIKKLGENPADRQSAAAAKLLQMLADEVRALRDAPAYQEYRAICGWLEEFDGMAELHEYAQDYRSRIGVDHFPANGEEYLRVLIGFAKDTFGAP*
Ga0070765_10062883713300006176SoilVSATDLPEAIELERTADWRIKKLGEDPADEVSAGAARLLQKLADDLRALAGSPAFREYQAICGWLDEFDGMAELSEYAHDYRLRIGVDHFPADGEAYLRVLIGFARDTFGAP*
Ga0105240_1086027523300009093Corn RhizosphereMGAPSSDLLEAIELERTADWRIKKLGENPSDKESETAAKLLQSLADDLRALRLSPVYKEYQAICGWLDEFDGMAELSEYAHDYRVRIGVDRFPADGEEYLRVLIGFAKDTFGTR*
Ga0126373_1254494023300010048Tropical Forest SoilLELERTADWRIKKLGENPDDAESARAAQLLQQLADDLRALAGSPAYREYQAICGWLDEFDGMAELAEYAQDYRVRIGIDKFPEGGEEYLRVLIGFAKDTFGAP*
Ga0126373_1255124613300010048Tropical Forest SoilMVAHSGSGVPEALELERAADWRIRKLGANPDDAESARAAKLLQKLAEEMRALAGSPAYREYQAICGWLDEFDGMAELAEYAQEYRARIGIDKFPDTGEAYLRVLIGFAKDTFGAA*
Ga0134125_1143333423300010371Terrestrial SoilMDDPEEAVELERIADWRIKKLGEDSSDAVSATAAKLLQKLADELRALTGSPAYAEYRAICGWLDEYDGREDFAERAHGYRLGIGVEHFPASGEEYLRAVTGFARETFGG*
Ga0126381_10004408533300010376Tropical Forest SoilMTDLPEALELERTADWRIKKLGENPDDAESARAAQLLQQLADDLRALAGSPAYREYQAICGWLDEFDGMAELAEYAQDYRVRIGIDKFPEGGEEYLRVLIGFAKDTFGAP*
Ga0134126_1018692023300010396Terrestrial SoilMDDPEEAVELERIADWRIKKLGEDSSDTVSATAAKLLQKLADELRALTGSPAYAEYRAICGWLDEYDGREDFAERAHGYRLGIGVEHFPASGEEYLRTLTGFARETFGG*
Ga0120132_107628723300013832PermafrostMSAPSSDLLEAIELERMADWRIKKLGDNPSDLESKTAAKLLQTLADHLRARRLSAVYREYQAICGWLDEFDGMAELSEYAHDYRVRIGVDRFPADGEVEKILARH*
Ga0181518_1022514323300014156BogMAENDPLEAVELERAADWRIKKLGEDPADEVSAGAAKLLQKLADDLRALAGSPAYREYQAICGWLDEFDGMAELSEYAHDYRLRIGVDHFPADGEAYLRVLIGFAKDTFGTP*
Ga0181530_1000306723300014159BogMLDQFPPRRNEEPPMAENDPLEAVELERAADWRIKKLGEDPADEVSAGAAKLLQKLADDLRALAGSPAYREYQAICGWLDEFDGMAELSEYAHDYRLRIGVDHFPADGEAYLRVLIGFAKDTFGTP*
Ga0181526_1086107123300014200BogIELERAADWRIKKLGENPDDWQSAEAAELLQMLADEVRGLAGFGLPVYREYQAICGWLDEFDGMAELLEYAQDYRARIGIDKFPVDGEEYLRVLIGFAKDTFGAP*
Ga0181537_10002215113300014201BogMCNADVLEAAELERAADWRIRKLGENPDDSESAAAAKLLQKLADDLRALAGSPAYREYQAICGWLDEFDGMAEFAEYAHDYRLRIGADKFPANGEAYLRVLIGFARDTFGSP*
Ga0182015_1001570643300014495PalsaMRNPEAPPLAADDPLEAVELERTADWRIRKLGENPENAESAEAAKLLQKLADDVRALAGSPIYREYQAICGWLDEFDGMAELSEYAHDYRTRIGVDRFLADGEEYLRVLIGFAKDAFGAP
Ga0182024_1000933553300014501PermafrostMLDQFPRRHEYLPMQGDDPLEAAELERTADWRIKKLGENPNDAESATAAQLLQKLADEIRALAGSPAYREYQAICGWLDEFDGMAELGEYAHDYRLRIGIDHFPADGEAYLRVLIGFAKDIFGAP*
Ga0182024_1001298083300014501PermafrostMAEHDLLEAVELEHTADWRIRKLGENPADSHGAAAAKLLQKLADDVGSLAGSPVYREYQAICAWLDEFDGMAELSEYAHDYRARIGIDRFPADGEDYLRVLIGFAKDTFGMP*
Ga0182024_1158390323300014501PermafrostMVGVGPGLRRGGEKKGARVSNADLPEAIELERTADWRIKKLGANPADRESAEAAKLLQKLADELRALAGSPIDREYQAICGWLDEFDGMAELSEYAQEYRRRIGVDRFPADGEAYLRVLIGFAKDTFGGS*
Ga0181525_1018165013300014654BogRAADWRIRKLGENPDDSESAAAAKLLQKLADDLRALAGSPAYREYQAICGWLDEFDGMAEFAEYAHDYRLRIGADKFPANGEAYLRVLIGFARDTFGSP*
Ga0181522_1044878813300014657BogMADNDPLEAIELERTADWRIKKLGENPGDADSARAAKLLQKLADDLRGLSGSPAYREYQAICGWLDEFDGMAELGEYAQDYRARIGIDKFPADGEEYLHVLIGFAKDTFGAP*
Ga0187825_1036139213300017930Freshwater SedimentRNSETAAKLLQQLADDLRTRRGSAAYQEYQAICGWLDEFDGMAELGEYAQDYRARIGIDKFPAGGEEYLRVLIGFAKDTFGAP
Ga0187778_1100555223300017961Tropical PeatlandMPAADLPEAIELERAADWRIKKLGENPSDRLSAAAAQLLQKLADDLRGLAGSPAWREYQAICGWLDEFDGMAELGEYAQDYRARIGVDQFPADGEAYLRVLIGFAKETFGAP
Ga0187780_1075759223300017973Tropical PeatlandSDRLSAAAAQLLQKLANDLRGLAGSPAWREYQAICGWLDEFDGMAELGEYAQDYRARIGIDKFPADGEEYLRVLIGFAKDTFGAP
Ga0187816_1045432923300017995Freshwater SedimentNEETRPLAENDPFEAIELERAADWRIKKLGENPGDAESETAAKLLQRLADDVRALTGSATYKEYQAICGWLDEFDGMAELAEYAQDYRIRIGVDRFPGNGEEYLRVLIGFAKDTFGAP
Ga0187871_1035630813300018042PeatlandMAEEDPLEAVELERTADWRIKKLGEDPTDRVSAGAARLLQKLADDLRALAGSPAFREYQAICGWLAEFDGMAELSEYAHDYRLRIGVDLFPADGEAYLRVLIGFATDTFGAP
Ga0187784_1026812323300018062Tropical PeatlandMNPRPADDLPEALELERIADWRIRKLGENPDDRQSEQAAKLLQKLADDLRALDGSPAYREYQAICGWLDEFDGMAELSEYAHDYRLRIGVDRFPANGEDYLRVLIGFARDAFGAP
Ga0187771_1005090343300018088Tropical PeatlandLADSDPHEAIELERAADWRIRKLGENPGDAESAAAAKLLQKLADDVRGLTGSAAYKEYQAICGWLDEFDGMAELAEYAQDYRARIGVDRFPANGEEYLRMLIGFAKDTFGTP
Ga0187771_1146187713300018088Tropical PeatlandLTENDPIEAIELERTADWRIRKLGENPGDAESARAAELLQRLADNLRAMTGSATYKEYQAICGWLDEFDGMAELAEYAHDYRLRIGVDKFPRNGEDYLRVLIGFAKDTFGSP
Ga0210407_1091342223300020579SoilAEPLVPACAGTTQACYMSASDLPEAIELERTADSRIKKLGENPADRQSAAAAELLQKLADEVRALRDAPAYQEYRAICGWLDEFDGMAELHEYAQDYRSRIGVDQFPANGEEYLRVLIGFAKHTFGAP
Ga0210399_1039820123300020581SoilMNDPDVAEAIELERTADWRIKKLGENPDDWQSAEAAELLQMLADEVRGLAMFGSSAYREYQAICGWLDEFDGRAELSEYAQDYRARIGIDKFPTDGEEYLRVLIGFAKETFGAP
Ga0210401_1114282523300020583SoilMADTDPFEAIELERAADWRIKKLGENPDDRQSGAAAKLLQKLADDLRALAGSPAYTEYQAICGWLDEFDGMAELQEYAQDYRAQIGIDKFPVDGEEYLRVLIGFAKDAFGAP
Ga0210396_1112368713300021180SoilEPLVPACAGTTQACYMSASDLPEAIELERTADSRIKKLGENPADRQSAAAAELLQKLADEVRALRDAPAYQEYRAICGWLDEFDGMAELHEYAQDYRSRIGVDQFPANGEEYLRVLIGFAKHTFGAP
Ga0210388_1010714523300021181SoilLAHQKLGENPGDADSARAAKLLQKLADDLRGLSGSPAYREYQAICGWLDEFDGMAELNEYAQDYRARIGVDKFPAEGEDYLRVLIGFAKDTFGAP
Ga0210388_1029344123300021181SoilMAEDDPLEASELERIADWRIRKLGENPADAESAAAAKLLQKLADDLRALTGSPTYNEYQAICGWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP
Ga0210388_1117726123300021181SoilSRHLPVGAIGAMLEQFPRPRNEGDAAMAENDPLEAIELERTADWRIKKLGENPADTVSDDAARLLQKLADDLRALAGSPIYREYQAICGWLDEFDGMAELSEYAHDYRLRIGIDYFPAGGDAYLKVLIGFAKETFGAP
Ga0210393_1004124743300021401SoilMTVNDPHEAIELERAADWRVRKLGENPDDAESAAAAKLLQRLADDVRGLTGSATYREYQAICGWLDEFDGMAELAEYAQDYRIRIGVDRFPASGEEYLRVLIGFAKDTFGAP
Ga0210393_1012246423300021401SoilMAENDPLEAIELERTADWRIKKLGEDPADTVSDDAARLLQKLADDLRALAGSPIYREYQAICGWLDEFDGMAELSEYAHDYRLRIGIDHFPADGEAYLRVLIGFAKETFGTP
Ga0210393_1037278523300021401SoilMAEDDPLEASELERIADWRIRKLGENPADAESAAAAKLLQKLADDLRTLTGSPTYNEYQAICGWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP
Ga0210385_1116760323300021402SoilMTVNDPHEAIELERAADWRVRKLGENPDDAESAAAAKLLQRLADDVRGLTGSATYREYQAICGWLDEFDGMAELAEYAQDYRIRIGVDRFPASGEGYLRVLIGFAKDTFGAP
Ga0210383_1008306633300021407SoilMADADPFEAIELDRAADWRIKRLGENSSDRQSEEAAKLLQKLADDLRTLAGSPAYQEYQAICGWLDEFDGMAELQEYAQDYRARIGVDKFPADGEEYLRVLIGFAKDTFGTP
Ga0210383_1103107323300021407SoilMSDPDLPEAIELERAADWRIRKLGENPADGASAAAANLLQKLADDMRGLAGSPLYREYQAICGWLDESEGTAELAAYAQDYRARIGIDKFPADGEEYLRVLIGFAKDAFGAP
Ga0210394_1131984513300021420SoilMADADPFEAIELDRAADWRIKRLGENSSDRQSEEAAKLLQKLADDLRTLAGSPAYKEYQAICGWLDEFDGMAELQEYAQDYRARIGVDKFPADGEEYLRVLIGFAKDTFGTP
Ga0210391_1084651013300021433SoilVSATDLPEAIELERTADWRIKKLGEDPTDRVSARAAALLQKLADDLRGRADSSAYREYQAISGWLDEFDGMAELSEYAHDYRLRIGVDHFPADGEAYLRVLIGFARDTFGAS
Ga0210398_1033629123300021477SoilMTENDPPEAIELERMADWRIKKLGENPDDADSARAAELLQKLADDVRKLAGSPALREYQAICGWLDEFDGMAELAEYARDYRVRIGIDKFPDDGEAYLRVLI
Ga0210398_1056297123300021477SoilLDDLPEAVELERAADWRIRKLGDNPGDAESAAAARLLQKLADDLRALAGSPAYREYPAICGWLDEFDGMAELAEYAHDYRTRIGVDRFPADGGDYLRVLIGFATETFSAP
Ga0210398_1107191913300021477SoilLAPGGHEGPRRGPNPAITSKEAVRSETLMTVNDPHEAIELERAADWRVRKLGENPDDAESAAAAKLLQRLADDVRGLTGSATYREYQAICGWLDEFDGMAELAEYAQDYRIRIGVDRFPASGEEYLRVLIGFAKDTFGAP
Ga0210410_1083358223300021479SoilAGWRIKRLGENSSDRQSEEAAKLLQKLADDLRTLAGSPAYKEYQAICGWLDEFDGMAELQEYAQDYRARIGVDKFPADGEEYLRVLIGFAKDTFGTP
Ga0210409_1021313123300021559SoilMNDPDVAEAIELERTADWRIKKLGENPDDWQSAEAAELLQMLADEVRGLAMFGSSAYREYQAICGWLDEFDGRAELSEYAQDYRARIGIDKFPTDGEEYLRVLIGFAKE
Ga0207695_1073653423300025913Corn RhizosphereMGAPSSDLLEAIELERTADWRIKKLGENPSDKESETAAKLLQSLADDLRALRLSPVYKEYQAICGWLDEFDGMAELSEYAHDYRVRIGVDRFPADGEEYLRVLIGFAKDTFGTR
Ga0209008_109650123300027545Forest SoilIRKLGENPADAESAAAAKLLQKLADDLRALTGSPTYNEYQAICGWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP
Ga0209726_10000752383300027815GroundwaterMPADDPVEVVELERVADWRIKKLGENPSDTDSAGAAKLLQKLADDLRGLAGSPVYAEYRAICGWLDEYQGIEDFAERAHEYRTRIGIDRFPADGEEYLRILTGFAKETFGA
Ga0209167_1004808023300027867Surface SoilVSDPDIPEAVELEQAADWRIKRLGADPSDRQSETAAKLLQKLADDLRVLVGSPLYREYQAICGWLDEFDGMAELAEYAHDYRARIGIDKFPADGAEYLRVLIGFARDAFGAP
Ga0209624_1003593743300027895Forest SoilRIADWRIRKLGENPADAESAAAAKLLQKLADDLRTLTGSPTYNEYQAICSWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP
Ga0209006_10001083213300027908Forest SoilMAEDDPLEASELERIADWRIRKLGENPADAESAAAAKLLQKLADDLRTLTGSPTYNEYQAICSWLDEFDGMAEHAEYAHDYRLRIGVDHFPASGEDYLRVLIGFAKDIFGAP
Ga0209006_1043760813300027908Forest SoilMSGPSAPDLLEATELERTADWRIKKLGEDPSDGQSETAARLLQQLADDLRAIRGSSTYREYQAICGWLDEFDGMAELSEYAHDYRARIGIDQFPA
Ga0209168_1013757923300027986Surface SoilMSRPSENDLPEAVELERAADWRISKLGGNPDDAESAAAARLLQQLADEVRSLAGSPTYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDKFPANGEDYLKVLIGFAKETFGAP
Ga0209168_1015669323300027986Surface SoilVSDPDIPEAVELEQAADWRIKRLGADPSDRQSETAAKLLQKLADDLRVLVGSPLYREYQAICGWLDEFDGMAELAEYGHDYRARIGIDKFPADGAEYLRVLIGFARDAFGAP
Ga0302223_1022644023300028781PalsaEEVKAVNDPFSRNEDPMEAVELERAADWRIKKLGENPSDRESAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0265338_1087438623300028800RhizosphereDEPPEIGELERTADWRIKKLGENPGDAASAGAAERLQKLADDLRALAGSAIYREYQAICGWLDEFDGMAELGEYAHAYRLRIGIDRFPADGEEYLRALIGFAKDTFGAP
Ga0308309_1003510423300028906SoilVSATDLPEAIELERTADWRIKKLGEDPADEVSAGAARLLQKLADDLRALAGSPAFREYQAICGWLDEFDGMAELSEYAHDYRLRIGVDHFPADGEAYLRVLIGFARDTFGAP
Ga0222749_1047802323300029636SoilMHDDDLSEAIELERAADWRIKKLGENPTDRQSADAAKLLQKLADEVRALRDAPAYQEYRAICGWLDEFDGMAELHEYAQDYRARIGVDHFPANGEEYLRVLIGFAKNTFGT
Ga0311340_1008947423300029943PalsaVNDPFSRNEDPMEAVELERAADWRIKKLGENPSDRESAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0311371_1216855213300029951PalsaPPLERDDVDGRDRPGHDRELVMAENDLLETVELERTADWRIKKLGENPSDRESAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0311339_1036436923300029999PalsaVNDPFSRNEDPMEAVELERTADWRIKKLGENPSDRESAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0311338_1006831423300030007PalsaMAENDLLEAVELERTADWRIKKLGENPSDRDSAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0311357_1012879523300030524PalsaLRIKKLGENPSDRDSAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0311354_1062064523300030618PalsaVELERTADWRIKKLGENPSDRDSAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRVLIGFAKDTFGAP
Ga0073996_1227704813300030998SoilMPDQRGDRADSHEVVELERAADWRIRKLEENPADRESTAAARLLQKLADDLRRLAGSPVYQEYLAICGWLDEYDGMADFADRAREYRAQIGIDEFPADGEAYLRVLIGFAKDTFGA
Ga0170824_12658843523300031231Forest SoilWRIKRLGENSSDRQSEEAAKLLQKLADDLRTLAGSPAYKEDQAICGWLDEFDGMAELQEYAQDYRARIGVDKFPADGEEYLRVLIGFAKDIFGAP
Ga0302325_1136432623300031234PalsaLELERTADWRIKKLGENPEDGESAAAAALLQKLADEVRTLTASPTYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDRFPASGEEYLRVMIGFAKETFGTP
Ga0302325_1213532713300031234PalsaVDGRVKLGHDRELVMAENDLLEAVELERTADWRIKKLGENPSDQESAEAAKLLQKLADDLRALTGSPLYNEYQAICGWLDEFDGMAELAEYAHDYRVRIGADKFPADGEEYLGVLIGFAKATFGAL
Ga0302324_10016102643300031236PalsaMAENDLLEAVELERTADWRIKKLGENPSDRDSAEAAKLLQKLADDLRRLCGSPTYKEYQAICGWLDEFDGMAELAEYAHDYRVRIGVDKFPANGEEYLRV
Ga0302324_10090845923300031236PalsaMADADPPEALELERTADWRIKKLGENPEDGESAAAAALLQKLADEVRTLTASPTYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDRFPASGEEYLRVMIGFA
Ga0170820_1278875813300031446Forest SoilDADPFEAIQLERAADWRIKRLGENSSDRQSEEAAKLLQKLADDLRTLAGSPAYKEDQAICGWLDEFDGMAELQEYAQDYRARIGVDKFPADGEEYLRVLIGFAKDIFGAP
Ga0310686_10267912723300031708SoilMPDDPLEATELERTADWRIKKLGENPADRQSAEAAKLLQQLADEVRALTGSPIYQEYQAICGWLDEFDGMAELSEYAHDYRLRIGVDHFPATGEDYLRVLIGFAKDALGAP
Ga0310686_11855815113300031708SoilLGENPADTESAAAAKLLQKLADDLRALAGSPAYREYQAICGWLDEFDGTAELGEYAQDYRARIGVDKFPGSGEDYLRVLIGFAKDTFGAP
Ga0307476_1015723523300031715Hardwood Forest SoilMASDATPDPLEAIELERAADWRIRKLGENPNDAESAEAAKLLQKLADDLRALTGSPAYKEYQAICGWLDEFDGMAELSEYAHGYRLRIGVDHFPDDGEEYLRVLIGFAKDTFGTP
Ga0335079_1052165323300032783SoilAIELERAADWRIKKLGENLDDRKSAEAAKLLQKLADEVRVLAGSPVYREYQAICGWLDEFDGMAELSEYAEDYRARIGIDKFPADGEEYLRVLIGFAKDTFGAP
Ga0335079_1230347713300032783SoilAFAIMVQHVFRFVIPGKAGIQTSGARVLESWVPASAGTTIVCCMSTDVPEAIELERAADWRIKKLGENPDDRESAAAAKLLQKLADEVRGLIGSPVYREYQAICGWLDEFDGMAELGEYVQDYRARIGIDKFPADGEDYLRVLIGFAKDTFGAP
Ga0335078_1050456633300032805SoilARVLESWVPASAGTTIVCCMSTDVPEAIELERAADWRIKKLGENLDDRKSAEAAKLLQKLADEVRVLAGSPVYREYQAICGWLDEFDGMAELSEYAEDYRARIGIDKFPADGEEYLRVLIGFAKDTFGAP
Ga0335078_1112779823300032805SoilLAENDPHEAIELERAADWRIKKLGENSDDAESAAAAKLLQQLADDVRGLTGSAAYREYQAICGWLDEFDGMAELAEYAQDYRARIGVDRFPTNGEEYLRVLIGFAKDTFGAP
Ga0335078_1225934813300032805SoilMMSVSDPQEAIELERTADWRIRKLGANPDDQESETAAKLLQKLADDVRGLTGSAAYKEYQAICGWLDEFDGMAELAEYAQDYRARIGVDHFPANGEEYLRVLTGFAKDTFGAP
Ga0335081_1017629233300032892SoilMSTDVPEAIELERAADWRIKKLGENLDDRKSAEAAKLLQKLADEVRVLAGSPVYREYQAICGWLDEFDGMAELSEYAEDYRARIGIDKFPADGEEYLRVLIGFAKDTFGAP
Ga0335081_1149521623300032892SoilMEGDLREVVELERVADWRIRKLGENPGDAESAVAAALLQKLADELRGLAGSPAYAEYRAICGWLDEYDGMEDFAERAHAYRVGIGVEHFPADGEAYLRVLTGFARETFGA
Ga0335074_1010606863300032895SoilMFAARAAEAWAPACAGVVTRGKAMSSTSDLPEAIELERAADWRIRKLGENPGDVASAQAAKLLQRLADDIRGLARSPAYREYQAICGSLDEFDGMAELGEYAQDYRARIGPSLRT
Ga0335074_1083894823300032895SoilMTEADLPEAIELERAADWRIRKLGENPADRESAAAAALLQRLADDLRALTASPAWREYQAICGWLDEFDGTAELAEYAHAYRLRIGVEHFPADGEEYLRVLIGFGRDAFGAP
Ga0335075_1012895243300032896SoilMTEVDLPEAVELERTADWRIKKLGENPGDTDSARAAKLLQKLADDLRALRRSSAYREYQAICGWLDEFDGMAELNEYAQDYRARIGIDKFPADGEEYLRVLIGFAKDTFGAP
Ga0335075_1161336123300032896SoilSFSGGPGVCGDGGWGAMTATEIPEAVELERTADWRIKKLGENPSDTDSARAAKLLQKLADDLRGLIASPAYREYHAICGWLDEFDGMAELNEYAQEYRARIGIDKFPADGEEYLRVLIGFAKEAFGAP
Ga0335076_1028285623300032955SoilLAENDPHEAIELERAADWRIKKLGENSDDAESAAAAKLLQQLADDVRGLTGSATYKEYQAICGWLDEFDGMAELGEYAQDYRARIGVDRFPANGEEYLRVLIGFAKDTFGAP
Ga0335073_1033998623300033134SoilMSAPDLPEAAELERAADWRIKKLGENPDDAESARAAALLQTLADDVRRLADAPVYREYRAICAWLDEFDGMAELEEYAQDYRVRIGVDKFPTDGEAYLGVLIGFAKETFGMP
Ga0335073_1075583123300033134SoilVPNADLPEAVELERTADWRIRKLGENPADMKSAAAAKLLQKLADDLRNLVASPIYREYQAICGWLDEFDGMTELAGYAQDYRVRIGVDRFPASGEEYLRVLIGFAKEAFGAP
Ga0335073_1120306713300033134SoilMTEADLPEAIELERAADWRIRKLGENPADRESAAAAALLQRLADDLRALTASPAWREYQAICGWLDEFDGTAELAEYAHAYRLRIGVEHFPADGEEYLRVLIGFGRD
Ga0335073_1169426513300033134SoilWRIKKLGENPEDADSARAAELLQKLADDLRGLTGSPACREYQAICGWLDEFDGMAELAEYGRDYRARIGIDKFPADGEAYLHVLIDFAKDTFGGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.