| Basic Information | |
|---|---|
| Family ID | F095815 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GPQGSTFVSPSTLPASTASAPLGTSAAGNYYAGSANLG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 87.62 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.095 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.619 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.095 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02803 | Thiolase_C | 19.05 |
| PF04185 | Phosphoesterase | 6.67 |
| PF00083 | Sugar_tr | 2.86 |
| PF01545 | Cation_efflux | 1.90 |
| PF13365 | Trypsin_2 | 1.90 |
| PF02687 | FtsX | 0.95 |
| PF13701 | DDE_Tnp_1_4 | 0.95 |
| PF05598 | DUF772 | 0.95 |
| PF00210 | Ferritin | 0.95 |
| PF00146 | NADHdh | 0.95 |
| PF02659 | Mntp | 0.95 |
| PF03734 | YkuD | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 19.05 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 6.67 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.90 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.90 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.90 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.95 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.95 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 0.95 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.10 % |
| All Organisms | root | All Organisms | 41.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005434|Ga0070709_10205018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1398 | Open in IMG/M |
| 3300005436|Ga0070713_100953424 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005436|Ga0070713_102084036 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005436|Ga0070713_102430205 | Not Available | 506 | Open in IMG/M |
| 3300005439|Ga0070711_101545775 | Not Available | 579 | Open in IMG/M |
| 3300005440|Ga0070705_100022691 | All Organisms → cellular organisms → Bacteria | 3357 | Open in IMG/M |
| 3300005578|Ga0068854_102115550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300005602|Ga0070762_10699818 | Not Available | 680 | Open in IMG/M |
| 3300006176|Ga0070765_100083515 | Not Available | 2717 | Open in IMG/M |
| 3300006176|Ga0070765_100458558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1195 | Open in IMG/M |
| 3300006804|Ga0079221_10553937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300006804|Ga0079221_11746041 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006806|Ga0079220_10138576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1325 | Open in IMG/M |
| 3300006806|Ga0079220_11077582 | Not Available | 648 | Open in IMG/M |
| 3300006904|Ga0075424_101675455 | Not Available | 674 | Open in IMG/M |
| 3300007076|Ga0075435_100667752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 902 | Open in IMG/M |
| 3300007076|Ga0075435_101423660 | Not Available | 607 | Open in IMG/M |
| 3300009523|Ga0116221_1130039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1102 | Open in IMG/M |
| 3300009623|Ga0116133_1188919 | Not Available | 551 | Open in IMG/M |
| 3300009672|Ga0116215_1162453 | Not Available | 990 | Open in IMG/M |
| 3300009672|Ga0116215_1520219 | Not Available | 514 | Open in IMG/M |
| 3300009698|Ga0116216_10521357 | Not Available | 718 | Open in IMG/M |
| 3300010375|Ga0105239_11215173 | Not Available | 869 | Open in IMG/M |
| 3300010379|Ga0136449_102061392 | Not Available | 839 | Open in IMG/M |
| 3300010401|Ga0134121_11185660 | Not Available | 762 | Open in IMG/M |
| 3300010880|Ga0126350_10113069 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012189|Ga0137388_10730199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300012205|Ga0137362_10370929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1240 | Open in IMG/M |
| 3300012357|Ga0137384_10109578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2306 | Open in IMG/M |
| 3300012359|Ga0137385_11628205 | Not Available | 509 | Open in IMG/M |
| 3300012925|Ga0137419_11542463 | Not Available | 564 | Open in IMG/M |
| 3300012961|Ga0164302_10086158 | Not Available | 1691 | Open in IMG/M |
| 3300013296|Ga0157374_10642465 | Not Available | 1073 | Open in IMG/M |
| 3300013308|Ga0157375_10548873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1317 | Open in IMG/M |
| 3300014487|Ga0182000_10057365 | Not Available | 1187 | Open in IMG/M |
| 3300016270|Ga0182036_11626669 | Not Available | 544 | Open in IMG/M |
| 3300016341|Ga0182035_10934224 | Not Available | 766 | Open in IMG/M |
| 3300017928|Ga0187806_1208799 | Not Available | 664 | Open in IMG/M |
| 3300017934|Ga0187803_10387907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 565 | Open in IMG/M |
| 3300017959|Ga0187779_10138540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1493 | Open in IMG/M |
| 3300017995|Ga0187816_10162523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
| 3300018037|Ga0187883_10369912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 733 | Open in IMG/M |
| 3300018046|Ga0187851_10140956 | Not Available | 1466 | Open in IMG/M |
| 3300018046|Ga0187851_10339381 | Not Available | 866 | Open in IMG/M |
| 3300018058|Ga0187766_10035416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2906 | Open in IMG/M |
| 3300018058|Ga0187766_10727521 | Not Available | 687 | Open in IMG/M |
| 3300018085|Ga0187772_11003690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300018085|Ga0187772_11417434 | Not Available | 516 | Open in IMG/M |
| 3300020580|Ga0210403_10937237 | Not Available | 681 | Open in IMG/M |
| 3300021180|Ga0210396_10256408 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300021403|Ga0210397_10249673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1287 | Open in IMG/M |
| 3300021404|Ga0210389_10687980 | Not Available | 801 | Open in IMG/M |
| 3300021404|Ga0210389_11191435 | Not Available | 586 | Open in IMG/M |
| 3300021405|Ga0210387_10194853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1755 | Open in IMG/M |
| 3300021405|Ga0210387_11815409 | Not Available | 513 | Open in IMG/M |
| 3300021433|Ga0210391_10639754 | Not Available | 834 | Open in IMG/M |
| 3300021474|Ga0210390_10334488 | Not Available | 1282 | Open in IMG/M |
| 3300021474|Ga0210390_11127260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 636 | Open in IMG/M |
| 3300024286|Ga0247687_1076870 | Not Available | 515 | Open in IMG/M |
| 3300024288|Ga0179589_10015710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2394 | Open in IMG/M |
| 3300024288|Ga0179589_10434650 | Not Available | 604 | Open in IMG/M |
| 3300024290|Ga0247667_1064583 | Not Available | 675 | Open in IMG/M |
| 3300025927|Ga0207687_10161588 | Not Available | 1720 | Open in IMG/M |
| 3300025945|Ga0207679_11669703 | Not Available | 583 | Open in IMG/M |
| 3300026322|Ga0209687_1096939 | Not Available | 958 | Open in IMG/M |
| 3300027725|Ga0209178_1201491 | Not Available | 705 | Open in IMG/M |
| 3300027775|Ga0209177_10002173 | All Organisms → cellular organisms → Bacteria | 3646 | Open in IMG/M |
| 3300027895|Ga0209624_10042734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2895 | Open in IMG/M |
| 3300028747|Ga0302219_10320493 | Not Available | 604 | Open in IMG/M |
| 3300028775|Ga0302231_10419785 | Not Available | 564 | Open in IMG/M |
| 3300028806|Ga0302221_10147306 | Not Available | 1037 | Open in IMG/M |
| 3300028906|Ga0308309_11167027 | Not Available | 665 | Open in IMG/M |
| 3300030618|Ga0311354_11302528 | Not Available | 652 | Open in IMG/M |
| 3300030618|Ga0311354_11735460 | Not Available | 544 | Open in IMG/M |
| 3300030739|Ga0302311_10191384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1558 | Open in IMG/M |
| 3300030741|Ga0265459_10818742 | Not Available | 931 | Open in IMG/M |
| 3300031027|Ga0302308_10740136 | Not Available | 553 | Open in IMG/M |
| 3300031234|Ga0302325_10360419 | Not Available | 2301 | Open in IMG/M |
| 3300031234|Ga0302325_10770372 | Not Available | 1366 | Open in IMG/M |
| 3300031236|Ga0302324_101467889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300031525|Ga0302326_13047551 | Not Available | 570 | Open in IMG/M |
| 3300031546|Ga0318538_10245644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 961 | Open in IMG/M |
| 3300031713|Ga0318496_10638516 | Not Available | 588 | Open in IMG/M |
| 3300031751|Ga0318494_10722753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300031765|Ga0318554_10619372 | Not Available | 609 | Open in IMG/M |
| 3300031768|Ga0318509_10005093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5211 | Open in IMG/M |
| 3300031770|Ga0318521_10194356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1170 | Open in IMG/M |
| 3300031778|Ga0318498_10264021 | Not Available | 775 | Open in IMG/M |
| 3300031778|Ga0318498_10374750 | Not Available | 634 | Open in IMG/M |
| 3300031798|Ga0318523_10285063 | Not Available | 824 | Open in IMG/M |
| 3300031821|Ga0318567_10258187 | Not Available | 979 | Open in IMG/M |
| 3300031823|Ga0307478_10051443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3057 | Open in IMG/M |
| 3300031893|Ga0318536_10549791 | Not Available | 579 | Open in IMG/M |
| 3300031962|Ga0307479_10022267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5995 | Open in IMG/M |
| 3300032010|Ga0318569_10223902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 873 | Open in IMG/M |
| 3300032064|Ga0318510_10416682 | Not Available | 574 | Open in IMG/M |
| 3300032091|Ga0318577_10399254 | Not Available | 657 | Open in IMG/M |
| 3300032261|Ga0306920_102083035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300032261|Ga0306920_103971554 | Not Available | 537 | Open in IMG/M |
| 3300032782|Ga0335082_11281016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300032828|Ga0335080_10675930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila | 1078 | Open in IMG/M |
| 3300032898|Ga0335072_10441698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1376 | Open in IMG/M |
| 3300033134|Ga0335073_10128315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3243 | Open in IMG/M |
| 3300033290|Ga0318519_10442207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070709_102050181 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TGMAVQADASGSKFVAPATLPADTASAPLGTSAVGNYNAA* |
| Ga0070713_1009534241 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVQAGPQGSTFVPPDSLPADTATAPLETSAHGNYYAGTANIG* |
| Ga0070713_1020840361 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TGQAVQAGPQGSTFVDPDSLPADTASAPLETSAPGNYYAHTANIG* |
| Ga0070713_1024302052 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVQAGPQGSTFVDPSSLPASTASAPLGTSATGNYFAGAANIR* |
| Ga0070711_1015457752 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEAVQAGPQGSTFVDPSSLPASTASAPLGTSATGNYFAGAANIR* |
| Ga0070705_1000226911 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SATGEAVQAGPQGSTFVSPDTLPASTASAPLGTSAHGNYYAGTANLG* |
| Ga0068854_1021155502 | 3300005578 | Corn Rhizosphere | VQAGPQGSTFVDPSSLPASTASAPLGTSATGNYFAGAANIR* |
| Ga0070762_106998181 | 3300005602 | Soil | VQAGPQGSTFVSPSSLPTSSASAPLGTSAAGNYYAGSANLG* |
| Ga0070765_1000835153 | 3300006176 | Soil | GSQFVAPSSLPADTASSPLDTSAAGNYYAGSANIATAG* |
| Ga0070765_1004585581 | 3300006176 | Soil | GSALGEAVEAGPQGSQFVSPSALPADTAAAPLGTSAAGNYFAGSANIG* |
| Ga0079221_105539372 | 3300006804 | Agricultural Soil | VQAGPQGSTFVSPDTLPVSTASAPLGTSAHGNYYARTANLG* |
| Ga0079221_117460412 | 3300006804 | Agricultural Soil | VQAGPQGSTFVDPSSLPASTASAPLGTSVAGNYFAGSANIG* |
| Ga0079220_101385761 | 3300006806 | Agricultural Soil | PQGSTFVAPDTLPASTASAPLGTSASGNYYAGTANLG* |
| Ga0079220_110775822 | 3300006806 | Agricultural Soil | GSTFVPPDSLPADTATAPLETSAHGNYYAGTANIG* |
| Ga0075424_1016754551 | 3300006904 | Populus Rhizosphere | GPQGSTFVAPDSLPADTANSPLETSAHGNYYANTANIR* |
| Ga0075435_1006677522 | 3300007076 | Populus Rhizosphere | VQAGPQGSTFVSPDTLPASTASAPLGTSASGNYYAGTANLG* |
| Ga0075435_1014236602 | 3300007076 | Populus Rhizosphere | AVQAGPQGSTFVSPDTLPASTASAPLGTSASGNYYAGTANLG* |
| Ga0116221_11300391 | 3300009523 | Peatlands Soil | QGSEFVSPSLLPADTASAPLGTSAAGNYYAGSANLG* |
| Ga0116133_11889192 | 3300009623 | Peatland | SALGEAVAAGPQGSTFVSRSSLPADTATAPLQTSAGGNYFAGAPSLG* |
| Ga0116215_11624531 | 3300009672 | Peatlands Soil | AGPQGSTFVSPSSLPADTATAPLQTSATGNYYAGAANLLG* |
| Ga0116215_15202192 | 3300009672 | Peatlands Soil | GPQGSTFVSPSSLPADTATAPLQTSATGNYYAGAANLLG* |
| Ga0116216_105213572 | 3300009698 | Peatlands Soil | PQGSTFVSPSSLPADTATAPLGTSASGNYYAGAANLG* |
| Ga0105239_112151732 | 3300010375 | Corn Rhizosphere | VQAGPQGSTFVDPSSLPASTASAPLSTSATGNYFAGAANIR* |
| Ga0136449_1020613922 | 3300010379 | Peatlands Soil | PQGSTFVSPSSLPPDTATAPLETSESGNWYANTSNIATIGSIG* |
| Ga0134121_111856602 | 3300010401 | Terrestrial Soil | EAVQAGPQGSTFVDPSSLPASTASAPLGTSVTGNYFAGAANIG* |
| Ga0126350_101130691 | 3300010880 | Boreal Forest Soil | QGSTFVSPSSLPADTATAPLETSASGNYYAGAANILG* |
| Ga0137388_107301992 | 3300012189 | Vadose Zone Soil | AGPQGSTFVSPSSLPADTASAPVETSAAGNYYAGSANLG* |
| Ga0137362_103709291 | 3300012205 | Vadose Zone Soil | GSTFVSPSSLPASTASAPLGTSAAGNYYASSANLG* |
| Ga0137384_101095781 | 3300012357 | Vadose Zone Soil | GSTFVSPTSLPASTATAPLGTSASGNYFAGAANLR* |
| Ga0137385_116282051 | 3300012359 | Vadose Zone Soil | STFVDPSSLPASTASAPLGTSAAGNYFAGSANLG* |
| Ga0137419_115424632 | 3300012925 | Vadose Zone Soil | GPQGSTFVSPSTLPASTASAPLGTSAAGNYYAGSANLG* |
| Ga0164302_100861581 | 3300012961 | Soil | QGSTFVSPDTLPASTASAPVGTSAHGNYYAGTANLG* |
| Ga0157374_106424651 | 3300013296 | Miscanthus Rhizosphere | EAVQAGPQGSTFVSPSTLPDSTASAPVGTSAHGNYFAGSANLG* |
| Ga0157375_105488731 | 3300013308 | Miscanthus Rhizosphere | STFVSPSTLPDSTASAPVGTSAHGNYFAGSANLG* |
| Ga0182000_100573651 | 3300014487 | Soil | GPQGSTFVDPSSLPASTATAPLGTSASGNYFARTANIR* |
| Ga0182036_116266691 | 3300016270 | Soil | AGPQGSTFVSPSSLTADTVSAPLQTSVAGNYYAGSANIG |
| Ga0182035_109342242 | 3300016341 | Soil | PQGSKFVSPSSLPASTAAAPLGNSVAGNYYAGSANLGVIQG |
| Ga0187806_12087991 | 3300017928 | Freshwater Sediment | MQAGPQGSQFVSPSSLPADTAASPLATSAAGNYYAGSANIG |
| Ga0187803_103879072 | 3300017934 | Freshwater Sediment | VQAGPQGSTFVSPSSLPADTASAPLGTSAPGNYYAGTANIG |
| Ga0187779_101385402 | 3300017959 | Tropical Peatland | GPQGSEFVSPSSLPADTASAPLETAAAGNYYAGSANLG |
| Ga0187816_101625232 | 3300017995 | Freshwater Sediment | PQGSEFVSPSALPADTASAPLGTSAAGNYFAGSADLG |
| Ga0187883_103699121 | 3300018037 | Peatland | MAVQAGPQGSTFVDPSSLPADTATAPLETSATGNYFAGSANIG |
| Ga0187851_101409561 | 3300018046 | Peatland | AGPQGSTFVSPSSLPADTATAPVQTSAAGNYYIGAPSLG |
| Ga0187851_103393812 | 3300018046 | Peatland | GEAVEAGPQGSTFVSPSSLPADTASAPLQTSAAGNYFAGAPSLG |
| Ga0187766_100354161 | 3300018058 | Tropical Peatland | GSALGEAVVAGPRGSKFVSPSSLPGDPTTAPLGTSAAGNYYAGTANMG |
| Ga0187766_107275212 | 3300018058 | Tropical Peatland | SALGQAVQAGPQGSQFVSPSSLPPDTATAPLGTSEAGNYDAYSGNIG |
| Ga0187772_110036902 | 3300018085 | Tropical Peatland | GEAVEAGPQGSQFVSPSSLPPDTATAPLGTSAAGNYYVGTANIG |
| Ga0187772_114174341 | 3300018085 | Tropical Peatland | SALGLAVEAGPQGSRFVPPSSLPADTATAPLGTAAAGNYFAGSPNIG |
| Ga0210403_109372372 | 3300020580 | Soil | EAVQAGPQGSTFVSPSSLAASTASAPLGTSAAGNYFAGSANLR |
| Ga0210396_102564081 | 3300021180 | Soil | QGSQFVSPSSLPADTASSPLETSATGNYYAGSANIG |
| Ga0210397_102496731 | 3300021403 | Soil | QAGPQGSHFVSPSSLSADTASSPLETSATGNYDAGSANIG |
| Ga0210389_106879802 | 3300021404 | Soil | SATGEVVQAGPQGSTFVDPSSLPASTASAPLGTSATGNYFAGSANVG |
| Ga0210389_111914351 | 3300021404 | Soil | TGDAVQAGPQGSTFVSPSTLPDSTASAPLGTSAHGNYYAGTANLG |
| Ga0210387_101948532 | 3300021405 | Soil | TAGPQGSTFVAPSSLPADTATAPLGTSAIGNYYAGSANLG |
| Ga0210387_118154092 | 3300021405 | Soil | QGSQFVSPSSLSADTASSPLSTSATGNYYAGSANVASVG |
| Ga0210391_106397541 | 3300021433 | Soil | GSQFVSPASLPADTASAPLGTSVAGNYYAGTSNLS |
| Ga0210390_103344881 | 3300021474 | Soil | SALGEAVEAGPQGSQFVSPASLPADTASAPLGTSVAGNYYAGTSNLE |
| Ga0210390_111272601 | 3300021474 | Soil | GSQFVSPSSLPADTASSPLETSAAGNYYAGSANIG |
| Ga0242659_11233902 | 3300022522 | Soil | VKGSALGMAGQAGPQGSHFVSPWLLPADTASSPLETSATGNCDA |
| Ga0247687_10768701 | 3300024286 | Soil | GPQGSTFVSPDTLPASTASAPVGTSAHGNYYAGTANLG |
| Ga0179589_100157102 | 3300024288 | Vadose Zone Soil | EAVQAGPQGSTFVSPSSLPASAASAPLGTSAAGNYFAGSANLR |
| Ga0179589_104346501 | 3300024288 | Vadose Zone Soil | QGSTFVSPDTLPASTVSAPLGTSAHGNYYAGTANLG |
| Ga0247667_10645832 | 3300024290 | Soil | QGSTFVSPDTLPASTASAPVGTSAHGNYYAGTANLG |
| Ga0207687_101615881 | 3300025927 | Miscanthus Rhizosphere | AVQAGPQGSTFVSPDTLPASTASAPLGTSAHGNYYAGTANLG |
| Ga0207679_116697031 | 3300025945 | Corn Rhizosphere | GSTFVSPDTLPVSTASAPLGTSAHGNYYAGTANLG |
| Ga0209687_10969391 | 3300026322 | Soil | GSTFVSPSSLPASTASAPLGTSASGNYFAGSANIR |
| Ga0209178_12014911 | 3300027725 | Agricultural Soil | GPQGSTFVSPSTLPASTASAPLGTSAHGNYYARTANLG |
| Ga0209177_100021731 | 3300027775 | Agricultural Soil | GQAVQAGPQGSTFVAPDTLPASTASAPLGTSASGNYYAGTANLG |
| Ga0209624_100427347 | 3300027895 | Forest Soil | DGSQFVSPSSLPADTAAAPLERSATGNYYAGSANIATVS |
| Ga0302219_103204931 | 3300028747 | Palsa | SALDEAVEAGPQGSTFVSPSSLPADTAAAPLQTSAAGNYYAGAAALG |
| Ga0302231_104197851 | 3300028775 | Palsa | SALDEAVEAGPQGSKFVSPSSLPADTGTTPLQTSAAGNYYAGTPALG |
| Ga0302221_101473061 | 3300028806 | Palsa | GPQGSQFVSPSSLPADIASSPLETSATGNYYAGTANIANVG |
| Ga0308309_111670272 | 3300028906 | Soil | GPQGSQFVAPSSLPADTASSPLDTSAAGNYYAGSANIATAG |
| Ga0311354_113025281 | 3300030618 | Palsa | GSTFVSPSSLPADNATAPLATSASGNYYAGAANLLG |
| Ga0311354_117354601 | 3300030618 | Palsa | QFVSPSSLPADTASSPLETSATGNYYAGTANIANVG |
| Ga0302311_101913841 | 3300030739 | Palsa | GPQGSQFVSPSSLPADTASSPLETSATGNYYAGTANIANVG |
| Ga0265459_108187422 | 3300030741 | Soil | VEAGPQGSKFVSPSSLPADTGTAPLQNSAAGNYYAGTPALG |
| Ga0302308_107401361 | 3300031027 | Palsa | GSTFVSRSSLPADTATAPLQTSAGGNYFAGAPSLG |
| Ga0302325_103604191 | 3300031234 | Palsa | GSTFVSPASLPADTAAAPLSTSAAGNYYAGAAWPT |
| Ga0302325_107703722 | 3300031234 | Palsa | VQAGPQGSTFVSPSSLPADTATAPGQTSAAGNYYAGAAALG |
| Ga0302324_1014678891 | 3300031236 | Palsa | PQGSTFVSPSSLPADTATAPRQTSAAGNYFAGAAALG |
| Ga0302326_130475512 | 3300031525 | Palsa | QGSTFVSPSSLPADTATAPRQTSAAGNYFAGAAALG |
| Ga0318538_102456441 | 3300031546 | Soil | SQYLRGSALGKAVEAGPRGSRFVSPASLPPDAATAPLGTSEAGNFGAGAANIG |
| Ga0318496_106385161 | 3300031713 | Soil | VQAGPQGSTFVSPSSLASSTASAPLGTSATGNFYAGSANLG |
| Ga0318494_107227531 | 3300031751 | Soil | VQAGPQGSEFVSPSSLPADTASAPLETSAAGNYYAGSANIG |
| Ga0318554_106193721 | 3300031765 | Soil | VQAGPQGSTFVSPSSLPASTASVPLGTSATGNFYAGSANLG |
| Ga0318509_100050931 | 3300031768 | Soil | FVSPSSLPADTASAPLETSAAGNYYAGSANIGSLTG |
| Ga0318521_101943561 | 3300031770 | Soil | TFSQYLRGSALGKAVEAGPRGSRFVSPASLPPDTATAPLGTSEAGNFGAGAANIG |
| Ga0318498_102640212 | 3300031778 | Soil | QAGPQGSTFVSPSSLAPSTASAPLGTSATGNFYAGSANLG |
| Ga0318498_103747501 | 3300031778 | Soil | GPQGSTFVSPSSLPASTASVPLGTSASGNYYAGSANLG |
| Ga0318523_102850631 | 3300031798 | Soil | GMAVQAGPQGSEFVSPSSLPADTASAPLETSVAGNYYAGSANIGSLTG |
| Ga0318567_102581871 | 3300031821 | Soil | VRAGPQGSTFVSPSSLPASIAAAPLGTSAAGNYYAGSANLGVVQG |
| Ga0307478_100514431 | 3300031823 | Hardwood Forest Soil | VEAGPSGSKFVSPSSLPADTATAPVGTSAAGNYFAG |
| Ga0318536_105497911 | 3300031893 | Soil | GSTFVDPSSLPASTASAPLGTSARGNYFAGTANLG |
| Ga0307479_100222675 | 3300031962 | Hardwood Forest Soil | GRAVVAGPQGSEFVSPSAAPPSTATAPQGTSAPGNYNAGAA |
| Ga0318569_102239021 | 3300032010 | Soil | GPQGSTFVSPSSLPASTASVPLGTSATGNFYAGSANLG |
| Ga0318510_104166822 | 3300032064 | Soil | VSPSSLPADTASAPLETSAAGNYYAGSANIGSLTG |
| Ga0318577_103992541 | 3300032091 | Soil | GQAVQAGPQGSTFVSPSSLPASTASVPLGTSATGNFYAGSANLG |
| Ga0306920_1020830352 | 3300032261 | Soil | VQAGPQGNTFVSPSSLPASTASVPLGTSATGNFYAGTANLG |
| Ga0306920_1039715541 | 3300032261 | Soil | GSIFVSPSSLPVDTASAPLGTSASGNYYAGSANLG |
| Ga0335082_112810161 | 3300032782 | Soil | SATGEAVQAGPQGSTFVSPSSLPASTASVPLGTSATGNFYAGSANLG |
| Ga0335080_106759301 | 3300032828 | Soil | GSTFVSPSSLPASTASAPLGTSASGNYYADSGNLG |
| Ga0335072_104416981 | 3300032898 | Soil | VEAGPSGSTFVSPASLPADTASSPLETSAYGNYDAGTANISG |
| Ga0335073_101283151 | 3300033134 | Soil | GPQGSTFVSPSSLPADTATVPLGTSAPGNYYAGSANLGVIG |
| Ga0318519_104422071 | 3300033290 | Soil | AGPQGSEFVSPSSLPADTASAPLETSAAGNYYAGSANLG |
| ⦗Top⦘ |