| Basic Information | |
|---|---|
| Family ID | F095765 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRDLD |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 32.38 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil (9.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 0.00% Coil/Unstructured: 89.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01408 | GFO_IDH_MocA | 15.24 |
| PF00795 | CN_hydrolase | 1.90 |
| PF13720 | Acetyltransf_11 | 0.95 |
| PF11008 | DUF2846 | 0.95 |
| PF01797 | Y1_Tnp | 0.95 |
| PF07676 | PD40 | 0.95 |
| PF14534 | DUF4440 | 0.95 |
| PF12867 | DinB_2 | 0.95 |
| PF00005 | ABC_tran | 0.95 |
| PF00485 | PRK | 0.95 |
| PF01546 | Peptidase_M20 | 0.95 |
| PF09413 | DUF2007 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.33 % |
| All Organisms | root | All Organisms | 46.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_11113467 | Not Available | 500 | Open in IMG/M |
| 3300004092|Ga0062389_100371045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
| 3300005180|Ga0066685_11046132 | Not Available | 537 | Open in IMG/M |
| 3300005610|Ga0070763_10586564 | Not Available | 645 | Open in IMG/M |
| 3300005921|Ga0070766_10492845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300005921|Ga0070766_11023036 | Not Available | 569 | Open in IMG/M |
| 3300006176|Ga0070765_102314899 | Not Available | 500 | Open in IMG/M |
| 3300006806|Ga0079220_11583795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → Anaeromyxobacter oryzae | 567 | Open in IMG/M |
| 3300007788|Ga0099795_10638303 | Not Available | 509 | Open in IMG/M |
| 3300009143|Ga0099792_10132919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300009522|Ga0116218_1057499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1765 | Open in IMG/M |
| 3300009524|Ga0116225_1088692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
| 3300009525|Ga0116220_10201017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300009525|Ga0116220_10512326 | Not Available | 545 | Open in IMG/M |
| 3300009665|Ga0116135_1066682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300009759|Ga0116101_1005600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2115 | Open in IMG/M |
| 3300009762|Ga0116130_1186483 | Not Available | 656 | Open in IMG/M |
| 3300010048|Ga0126373_11424440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300010343|Ga0074044_10203963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300010343|Ga0074044_11156531 | Not Available | 505 | Open in IMG/M |
| 3300010379|Ga0136449_100806022 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300010379|Ga0136449_100945685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300010398|Ga0126383_11883176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300012351|Ga0137386_10410459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300012351|Ga0137386_11066777 | Not Available | 572 | Open in IMG/M |
| 3300012354|Ga0137366_10905778 | Not Available | 620 | Open in IMG/M |
| 3300012924|Ga0137413_11130396 | Not Available | 621 | Open in IMG/M |
| 3300012927|Ga0137416_10653487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300012989|Ga0164305_11229235 | Not Available | 651 | Open in IMG/M |
| 3300014168|Ga0181534_10722016 | Not Available | 583 | Open in IMG/M |
| 3300014169|Ga0181531_10805209 | Not Available | 586 | Open in IMG/M |
| 3300014654|Ga0181525_10795407 | Not Available | 534 | Open in IMG/M |
| 3300015264|Ga0137403_11245273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300017823|Ga0187818_10524714 | Not Available | 532 | Open in IMG/M |
| 3300017934|Ga0187803_10229446 | Not Available | 734 | Open in IMG/M |
| 3300017936|Ga0187821_10502866 | Not Available | 506 | Open in IMG/M |
| 3300017937|Ga0187809_10280094 | Not Available | 610 | Open in IMG/M |
| 3300017943|Ga0187819_10454019 | Not Available | 733 | Open in IMG/M |
| 3300017946|Ga0187879_10210424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300017959|Ga0187779_11226262 | Not Available | 528 | Open in IMG/M |
| 3300017975|Ga0187782_10545344 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 889 | Open in IMG/M |
| 3300017988|Ga0181520_10468537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300017995|Ga0187816_10378048 | Not Available | 628 | Open in IMG/M |
| 3300018009|Ga0187884_10325099 | Not Available | 621 | Open in IMG/M |
| 3300018020|Ga0187861_10352117 | Not Available | 623 | Open in IMG/M |
| 3300018044|Ga0187890_10445800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300018047|Ga0187859_10567023 | Not Available | 637 | Open in IMG/M |
| 3300018085|Ga0187772_11130537 | Not Available | 575 | Open in IMG/M |
| 3300018085|Ga0187772_11295430 | Not Available | 539 | Open in IMG/M |
| 3300020579|Ga0210407_10511128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300021170|Ga0210400_10014644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6221 | Open in IMG/M |
| 3300021404|Ga0210389_10936798 | Not Available | 673 | Open in IMG/M |
| 3300021404|Ga0210389_10944907 | Not Available | 670 | Open in IMG/M |
| 3300021405|Ga0210387_10373013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300021407|Ga0210383_10068908 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
| 3300021477|Ga0210398_10372076 | Not Available | 1165 | Open in IMG/M |
| 3300023255|Ga0224547_1027767 | Not Available | 727 | Open in IMG/M |
| 3300025406|Ga0208035_1056790 | Not Available | 602 | Open in IMG/M |
| 3300025434|Ga0208690_1031393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300025905|Ga0207685_10849735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300025939|Ga0207665_10214932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300026318|Ga0209471_1251319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300026329|Ga0209375_1286208 | Not Available | 540 | Open in IMG/M |
| 3300027439|Ga0209332_1099847 | Not Available | 520 | Open in IMG/M |
| 3300027537|Ga0209419_1083508 | Not Available | 632 | Open in IMG/M |
| 3300027562|Ga0209735_1057549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300027565|Ga0209219_1010187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2162 | Open in IMG/M |
| 3300027567|Ga0209115_1160838 | Not Available | 501 | Open in IMG/M |
| 3300027591|Ga0209733_1125182 | Not Available | 636 | Open in IMG/M |
| 3300027648|Ga0209420_1167758 | Not Available | 595 | Open in IMG/M |
| 3300027652|Ga0209007_1018622 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300027884|Ga0209275_10131901 | Not Available | 1309 | Open in IMG/M |
| 3300027884|Ga0209275_10511228 | Not Available | 685 | Open in IMG/M |
| 3300027884|Ga0209275_10701423 | Not Available | 583 | Open in IMG/M |
| 3300027889|Ga0209380_10016092 | All Organisms → cellular organisms → Bacteria | 4261 | Open in IMG/M |
| 3300027889|Ga0209380_10376263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300027903|Ga0209488_10008493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7647 | Open in IMG/M |
| 3300027903|Ga0209488_10366326 | Not Available | 1070 | Open in IMG/M |
| 3300027908|Ga0209006_11377296 | Not Available | 541 | Open in IMG/M |
| 3300027911|Ga0209698_10664527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300028017|Ga0265356_1023235 | Not Available | 671 | Open in IMG/M |
| 3300028047|Ga0209526_10732244 | Not Available | 619 | Open in IMG/M |
| 3300028552|Ga0302149_1149640 | Not Available | 607 | Open in IMG/M |
| 3300028801|Ga0302226_10291139 | Not Available | 689 | Open in IMG/M |
| 3300028808|Ga0302228_10418475 | Not Available | 594 | Open in IMG/M |
| 3300028906|Ga0308309_10353067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300029952|Ga0311346_10761732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300029955|Ga0311342_10267868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
| 3300030043|Ga0302306_10430387 | Not Available | 504 | Open in IMG/M |
| 3300030503|Ga0311370_12388302 | Not Available | 512 | Open in IMG/M |
| 3300030706|Ga0310039_10054207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1768 | Open in IMG/M |
| 3300030706|Ga0310039_10225656 | Not Available | 729 | Open in IMG/M |
| 3300030946|Ga0075379_10910774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300030991|Ga0073994_10024042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300031199|Ga0307495_10139058 | Not Available | 617 | Open in IMG/M |
| 3300031234|Ga0302325_10709022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1446 | Open in IMG/M |
| 3300031247|Ga0265340_10557253 | Not Available | 504 | Open in IMG/M |
| 3300031474|Ga0170818_105766106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300031708|Ga0310686_103228078 | Not Available | 2498 | Open in IMG/M |
| 3300031708|Ga0310686_114488128 | Not Available | 696 | Open in IMG/M |
| 3300031823|Ga0307478_10325748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300031823|Ga0307478_10713242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300032805|Ga0335078_11350832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300032895|Ga0335074_10617483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300033158|Ga0335077_10177959 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030946 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_111134671 | 3300001686 | Soil | MPITQIPFQDPVAPPEKGQPEQLGLYDTQDWETAYRELDAR |
| Ga0062389_1003710451 | 3300004092 | Bog Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTRDWESAYRETDANVPHLL |
| Ga0066685_110461321 | 3300005180 | Soil | MPITQIPFQDPVAPAEPQPEQLGLYDARGWETAYRDLDAHV |
| Ga0070763_105865641 | 3300005610 | Soil | MPITQIPFQDPVAPPEKPQPEQLDLYESSDWETAYRELDR |
| Ga0070766_104928452 | 3300005921 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYKDLD |
| Ga0070766_110230361 | 3300005921 | Soil | MPITQIPFQDPVAPPEKPQPEQLDLYASDDWETAY |
| Ga0070765_1023148991 | 3300006176 | Soil | MPITQIPFQDPIAPPEKPQPEQLGLYDTEDWEQAYRELDAR |
| Ga0079220_115837951 | 3300006806 | Agricultural Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTQDWETAYRELD |
| Ga0099795_106383031 | 3300007788 | Vadose Zone Soil | MPITQIPFQDPVAAAEKPQPEQLGLYDAQGWETAYRAM |
| Ga0099792_101329191 | 3300009143 | Vadose Zone Soil | MPITQIPFQDPVAPPKPPPAEQQLSLYDAQGWESAYRDLDD |
| Ga0116218_10574992 | 3300009522 | Peatlands Soil | MPITQIPFQDPVAPPKKPQPEQLGLYDAQGWETAY |
| Ga0116225_10886922 | 3300009524 | Peatlands Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTQDWATAYRDLDERVP |
| Ga0116220_102010172 | 3300009525 | Peatlands Soil | MAITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYREVDDDAARVP |
| Ga0116220_105123261 | 3300009525 | Peatlands Soil | MPITQIPFQDPVAPEKAQPEQLELYHSQDWESAYRDLDSRVPH |
| Ga0116135_10666821 | 3300009665 | Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDARGWETAYRDL |
| Ga0116101_10056004 | 3300009759 | Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRDLDDDA |
| Ga0116130_11864832 | 3300009762 | Peatland | MPITQIPFQDPVAPEKPQPEQLGLYDAQGWETAYRD |
| Ga0126373_114244401 | 3300010048 | Tropical Forest Soil | MPITQIPFQDPVAPPEKSQPEQLELYQQQDWETAYRELD |
| Ga0074044_102039631 | 3300010343 | Bog Forest Soil | MPITQIPFQDPVAPPEKPQAEQLGLYDAKGWETAYRNL |
| Ga0074044_111565311 | 3300010343 | Bog Forest Soil | MPITQIPFQDPVAPDEKPQPEQLGLYDTQGWETAYRDLN |
| Ga0136449_1008060221 | 3300010379 | Peatlands Soil | MPITQIPFQDPAAPPEKPQPEQLGLYDAQGWETAYRDLDDDARVPHL |
| Ga0136449_1009456851 | 3300010379 | Peatlands Soil | MAITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYREVDDDA |
| Ga0126383_118831761 | 3300010398 | Tropical Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTEDWEQAYRDLDARVPHL |
| Ga0137386_104104591 | 3300012351 | Vadose Zone Soil | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWETAYRDLDAH |
| Ga0137386_110667771 | 3300012351 | Vadose Zone Soil | MPITQIPFQDPVAPPKPPPAEQQLGLYDAEGWETAYRDL |
| Ga0137366_109057781 | 3300012354 | Vadose Zone Soil | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWETAYRDLD |
| Ga0137413_111303962 | 3300012924 | Vadose Zone Soil | MPITQIPFQDPAAPPEKPQPEQLGLYDAQGWETAYRNL |
| Ga0137416_106534871 | 3300012927 | Vadose Zone Soil | MPITQIPFQDPVAPPKPPPAEQQLGLYDAQGWESAYRDMDDARVPQL |
| Ga0164305_112292351 | 3300012989 | Soil | MPITQIPFQDPVAPPEKNQPEQLGLYDQQDWETAYRELDARVP |
| Ga0181534_107220161 | 3300014168 | Bog | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWETAYRDQDAHVPHLLIQ |
| Ga0181531_108052091 | 3300014169 | Bog | MPITQIPFQDPVAPEKPQPEQLGLYDAQGWETAYRDLDDDARVPH |
| Ga0181525_107954071 | 3300014654 | Bog | MPITQIPFQDPVAPPEKPQPEQLGLYDSQGWEKAYRDLDDDARV |
| Ga0137403_112452732 | 3300015264 | Vadose Zone Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDVRDWETAYRDLDDH |
| Ga0187818_105247141 | 3300017823 | Freshwater Sediment | MPITQIPFQDPVAPLEKPQPEQLGLYDTQDWETAYRDL |
| Ga0187803_102294461 | 3300017934 | Freshwater Sediment | MAITQIPFQDPAPTAEKPLPEQLDLYTVREWEAAYRDLDAAVP |
| Ga0187821_105028661 | 3300017936 | Freshwater Sediment | MPITQIPFHDPVAPPPPEKQQPEQLGLYDSQDWEEAYRNLDA |
| Ga0187809_102800941 | 3300017937 | Freshwater Sediment | MPITQIPFQDPIAPPEKPQPEQLGLYDVRDWETAYRDMDDR |
| Ga0187819_104540192 | 3300017943 | Freshwater Sediment | MPITQIPFQDPVAPPEKSQPEQLGLYDQQDWETAYRELDARVPHLL |
| Ga0187879_102104242 | 3300017946 | Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDARGWETAYRDLDDDAA |
| Ga0187779_112262621 | 3300017959 | Tropical Peatland | MPITQIPFQDPAPPEEKPLPAQLDLYDARDWEAAYRNL |
| Ga0187782_105453441 | 3300017975 | Tropical Peatland | MPITQIPFQDPVAPEKPQPEQLALYDSVEWESAYQDFDARVPHLLIQ |
| Ga0181520_104685371 | 3300017988 | Bog | MPITQIPFQDPVAPPEKPQPEQLGLYDTQDWETTSSAEEAHVVPH |
| Ga0187816_103780481 | 3300017995 | Freshwater Sediment | MPITQIPFQDPVAPPEKPQPEQLGLYDADDWEAAYR |
| Ga0187884_103250991 | 3300018009 | Peatland | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWEEAYRDL |
| Ga0187861_103521171 | 3300018020 | Peatland | MPITQIPFQDPVAPPEKPQAEQLGLYDTKGWETAYRDLDDD |
| Ga0187890_104458001 | 3300018044 | Peatland | MPITQIPFQDPVAPPERPEPEQLGLYDVRDWETAY |
| Ga0187859_105670232 | 3300018047 | Peatland | MPITQIPFQDPVAPPERTEPEQLGLYDVRDWETAYRVPDANIPH |
| Ga0187772_111305371 | 3300018085 | Tropical Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDQQDWEEAYRELDARVP |
| Ga0187772_112954302 | 3300018085 | Tropical Peatland | MAITQIPFQDPAPPTERPLPQQLGLYDVRDWETAY |
| Ga0210407_105111282 | 3300020579 | Soil | MPITQIPFQDPVAPPKPPPAEQQLGLYDAQGWETAYRDLDDARVPH |
| Ga0210400_100146441 | 3300021170 | Soil | MPITQIPFQDPVAPEKPQTEQLALYDMQDWETDYAD |
| Ga0210389_109367981 | 3300021404 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAKGWETAYKAL |
| Ga0210389_109449071 | 3300021404 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDRQEWETAYKDMDDDA |
| Ga0210387_103730131 | 3300021405 | Soil | MPITQIPFQDPLAPPEKPQPEQLDLYASDDWETAY |
| Ga0210383_100689086 | 3300021407 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRDL |
| Ga0210398_103720761 | 3300021477 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRDLD |
| Ga0224547_10277672 | 3300023255 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDRQEWETAYKD |
| Ga0208035_10567901 | 3300025406 | Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDARGWETAYRDLDDDAARV |
| Ga0208690_10313931 | 3300025434 | Peatland | MPITQIPFQDPVAPPEKPQPEQLGLYDARGWETAY |
| Ga0207685_108497351 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPITQIPFQDPVAPPEKPQPEQLGLYNAQGWETAYRA |
| Ga0207665_102149321 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPITQIPFQDPVAPPEKSQPEQLGLYDQQDWETAYR |
| Ga0209471_12513191 | 3300026318 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWEPAY |
| Ga0209375_12862081 | 3300026329 | Soil | MPITQIPFQDPVAPPKPPPAEQQLGLYDAEGWETAYRDLDEAR |
| Ga0209332_10998471 | 3300027439 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDQQDWETAYRDLDAHVPHLLI |
| Ga0209419_10835081 | 3300027537 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDQQDWETAYRDLDAH |
| Ga0209735_10575491 | 3300027562 | Forest Soil | MPITQIPFQDPVAPEKPQPEQLGLYDAQGWETAYRDL |
| Ga0209219_10101873 | 3300027565 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTQNWETAYSDLDA |
| Ga0209115_11608382 | 3300027567 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRDLDDD |
| Ga0209733_11251822 | 3300027591 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDQQDWETAYRDLDA |
| Ga0209420_11677582 | 3300027648 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRE |
| Ga0209007_10186221 | 3300027652 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLDLYDVRDWENAYRVPDANIP |
| Ga0209275_101319011 | 3300027884 | Soil | MPITQIPFQDPVAPPEKPQAEQLGLYDSQGWETAYRDLDDDARVPH |
| Ga0209275_105112282 | 3300027884 | Soil | MPITQIPFQDPVAPPEKPQAEQLGLYDAAGWETAYR |
| Ga0209275_107014231 | 3300027884 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQEWETAYKSLDDDA |
| Ga0209380_100160925 | 3300027889 | Soil | MPITQIPFQDPVAPPEKPQAEQLGLYDSQGWETAYRDL |
| Ga0209380_103762632 | 3300027889 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYKDLDDDARVP |
| Ga0209488_100084931 | 3300027903 | Vadose Zone Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAY |
| Ga0209488_103663263 | 3300027903 | Vadose Zone Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWETAYRAL |
| Ga0209006_113772961 | 3300027908 | Forest Soil | MPITQIPFQDPVAPPEKPGPEQLGLYDTGDWETAYRDLD |
| Ga0209698_106645271 | 3300027911 | Watersheds | MAITQIPFQDPVAPPEKPQPEQLGLYDTQDWETAYRELDARV |
| Ga0265356_10232351 | 3300028017 | Rhizosphere | MPITQIPFQDPVAPPEKPQPEQLGLYDRQGWETAYK |
| Ga0209526_107322442 | 3300028047 | Forest Soil | MPITQIPFQDPVAPPDKPQPEQLGLYDTQNWETTFRD |
| Ga0302149_11496402 | 3300028552 | Bog | MPITQIPFQDPVAPPEKPQPEQLGLYDAQGWKTAYCDFDD |
| Ga0302226_102911391 | 3300028801 | Palsa | MPITQIPFQDPVAPPEKAQPEQLGLYDAQGWESAY |
| Ga0302228_104184752 | 3300028808 | Palsa | MPITQIPFQDPVAPPEKPQPEQLGLYDVRDWETAYR |
| Ga0308309_103530673 | 3300028906 | Soil | MPITQIPFQEPVAPPEKPQPEQLGLYDAQGWETAYRELDDDAARVPHL |
| Ga0311346_107617322 | 3300029952 | Bog | MPITQIPFQDPVAPPEKPQPEQLGLYDSQGWEKAYRDLDDD |
| Ga0311342_102678682 | 3300029955 | Bog | MPITQIPFQDPVAPPEKPQPEQLGLYDARGWETAYRDLDDDAAR |
| Ga0302306_104303871 | 3300030043 | Palsa | MPITQIPFQDPAAPPEKPQPEQLGLYDTLLWEADDPELDAH |
| Ga0311370_123883021 | 3300030503 | Palsa | MPITQIPFQDPVAPPEKPQPEQLGLYDAQEWETAYRDLDDDAR |
| Ga0310039_100542073 | 3300030706 | Peatlands Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTQDWETAYRDLDERVPHL |
| Ga0310039_102256562 | 3300030706 | Peatlands Soil | MPITQIPFQDPVAPEKAQSEQLELYDAQDWETAYRD |
| Ga0075379_109107742 | 3300030946 | Soil | MPITQIPFQDPAAPPEKPQPEQLGLYDTQDWETAYRDLDAHV |
| Ga0073994_100240422 | 3300030991 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAREWETAY |
| Ga0307495_101390581 | 3300031199 | Soil | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWETAYRDLDAHV |
| Ga0302325_107090221 | 3300031234 | Palsa | MPITQIPFQDPVAPPEKPQPEQLGLYDAQEWETAYRDADDDAR |
| Ga0265340_105572532 | 3300031247 | Rhizosphere | MPITQIPFQDPVAPEKPQPEQLGLYDTQDWETAYRDLDA |
| Ga0170818_1057661062 | 3300031474 | Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDTQDWETAY |
| Ga0310686_1032280782 | 3300031708 | Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQEWETAYRDL |
| Ga0310686_1144881281 | 3300031708 | Soil | MPITQIPFQDPVAAPEKPQPEQLGLYDAQGWETAYKDLDDDAR |
| Ga0307478_103257481 | 3300031823 | Hardwood Forest Soil | MPITQIPFQDPVAPPKPPPAEQQLGLYDAQDWETAYRDLDDARVPHLL |
| Ga0307478_107132422 | 3300031823 | Hardwood Forest Soil | MPITQIPFQDPVAPPEKPQPEQLGLYDAQEWETAYKNLDDD |
| Ga0335078_113508322 | 3300032805 | Soil | MPITQIPFQDPVAPPEKHEPEQLGLYDTQDWETAYKE |
| Ga0335074_106174831 | 3300032895 | Soil | MPITQIPFQDPVAPTEKPQAEQLELYAARDWETAYRE |
| Ga0335077_101779591 | 3300033158 | Soil | MPITQIPFQDPVAPPEKHEPEQLGLYDTQDWETAYRELDARVPHL |
| ⦗Top⦘ |