Metagenome / Metatranscriptome Family F095754

Basic Information
Family ID	F095754
Family Type	Metagenome / Metatranscriptome
Number of Sequences	105
Average Sequence Length	47 residues
Representative Sequence	TLEGGGGVTGKLARNVSVYGDASYLSSVSGESRITLKGNVGMRVTW
Number of Associated Samples	57
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	3.81 %
% of genes near scaffold ends (potentially truncated)	99.05 %
% of genes from short scaffolds (< 2000 bps)	88.57 %
Associated GOLD sequencing projects	53
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Unclassified (49.524 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.571 % of family members)
Environment Ontology (ENVO)	Unclassified (54.286 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (70.476 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 80.43% Coil/Unstructured: 19.57%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF07508	Recombinase	3.81
PF08241	Methyltransf_11	3.81
PF03401	TctC	2.86
PF12951	PATR	1.90
PF04392	ABC_sub_bind	1.90
PF13578	Methyltransf_24	0.95
PF01841	Transglut_core	0.95
PF10108	DNA_pol_B_exo2	0.95
PF00872	Transposase_mut	0.95
PF12728	HTH_17	0.95
PF03404	Mo-co_dimer	0.95
PF03797	Autotransporter	0.95
PF02899	Phage_int_SAM_1	0.95
PF01609	DDE_Tnp_1	0.95
PF13305	TetR_C_33	0.95
PF01925	TauE	0.95
PF00589	Phage_integrase	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	3.81
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.86
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.90
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.95
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.95
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.95
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.95
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.95
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	0.95
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	0.95
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.95
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.95
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.48 %
Unclassified	root	N/A	49.52 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.48 %
Unclassified	root	N/A	49.52 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	49.52 %
Unclassified	root	N/A	49.52 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.19 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.95 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	28.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	17.14 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	6.67 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.95 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.71 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1.90 %
Boseaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae	0.95 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.95 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.95 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.95 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.95 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.81 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.95 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.95 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.95 %
Bosea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea	0.95 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.95 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.95 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.95 %
unclassified Rhodanobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter	0.95 %
unclassified Methylocystis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis	0.95 %
unclassified Bosea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea	0.95 %
Agrobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium	0.95 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Agrobacterium tumefaciens complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.52 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.71 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1.90 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.95 %
Agrobacterium tumefaciens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	0.95 %
Methylocystis sp. B8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	0.95 %
Mesorhizobium sp. NBIMC_P2-C4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	0.95 %
Bosea sp. OK403	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	0.95 %
Rhodoplanes sp. JGI PP 4-B12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	0.95 %
Rhodanobacter sp. C01	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	0.95 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.95 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.95 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.95 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000956\|JGI10216J12902_116719700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	998	Open in IMG/M
3300005332\|Ga0066388_101216872	Not Available	1289	Open in IMG/M
3300005332\|Ga0066388_103275096	Not Available	827	Open in IMG/M
3300005332\|Ga0066388_105676193	Not Available	631	Open in IMG/M
3300005363\|Ga0008090_14538001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NBIMC_P2-C4	519	Open in IMG/M
3300005713\|Ga0066905_100511242	All Organisms → cellular organisms → Bacteria → Proteobacteria	1001	Open in IMG/M
3300005713\|Ga0066905_100684000	Not Available	878	Open in IMG/M
3300005713\|Ga0066905_100974497	All Organisms → cellular organisms → Bacteria → Proteobacteria	746	Open in IMG/M
3300005713\|Ga0066905_102003083	Not Available	537	Open in IMG/M
3300005713\|Ga0066905_102008936	Not Available	537	Open in IMG/M
3300005713\|Ga0066905_102216807	Not Available	512	Open in IMG/M
3300005764\|Ga0066903_100192292	Not Available	3034	Open in IMG/M
3300005764\|Ga0066903_100417453	Not Available	2219	Open in IMG/M
3300005764\|Ga0066903_104503287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	743	Open in IMG/M
3300005764\|Ga0066903_106340956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	617	Open in IMG/M
3300005764\|Ga0066903_107726816	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300005764\|Ga0066903_107897301	All Organisms → cellular organisms → Bacteria → Proteobacteria	546	Open in IMG/M
3300005764\|Ga0066903_108231927	All Organisms → cellular organisms → Bacteria → Proteobacteria	533	Open in IMG/M
3300005764\|Ga0066903_108862866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	510	Open in IMG/M
3300005764\|Ga0066903_108975945	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300006178\|Ga0075367_11052267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium tumefaciens	520	Open in IMG/M
3300010047\|Ga0126382_10159216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1557	Open in IMG/M
3300010048\|Ga0126373_11013042	Not Available	896	Open in IMG/M
3300010359\|Ga0126376_13015122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. OK403	520	Open in IMG/M
3300010360\|Ga0126372_11844819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	649	Open in IMG/M
3300010361\|Ga0126378_10850006	Not Available	1020	Open in IMG/M
3300010361\|Ga0126378_11154816	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300010361\|Ga0126378_11915547	Not Available	675	Open in IMG/M
3300010361\|Ga0126378_12805837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	556	Open in IMG/M
3300010366\|Ga0126379_11324024	Not Available	826	Open in IMG/M
3300010366\|Ga0126379_11449248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	792	Open in IMG/M
3300010366\|Ga0126379_11825168	Not Available	712	Open in IMG/M
3300010366\|Ga0126379_12884840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300010376\|Ga0126381_100511322	Not Available	1696	Open in IMG/M
3300010376\|Ga0126381_100536009	Not Available	1657	Open in IMG/M
3300010376\|Ga0126381_101532471	Not Available	963	Open in IMG/M
3300010376\|Ga0126381_103555863	Not Available	611	Open in IMG/M
3300010398\|Ga0126383_12421405	Not Available	610	Open in IMG/M
3300012948\|Ga0126375_10664144	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300012948\|Ga0126375_10996692	Not Available	682	Open in IMG/M
3300012961\|Ga0164302_11357983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	578	Open in IMG/M
3300012971\|Ga0126369_13169672	Not Available	539	Open in IMG/M
3300012971\|Ga0126369_13350957	Not Available	525	Open in IMG/M
3300014871\|Ga0180095_1107791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	519	Open in IMG/M
3300015373\|Ga0132257_103448529	Not Available	575	Open in IMG/M
3300016319\|Ga0182033_10116810	All Organisms → cellular organisms → Bacteria	1997	Open in IMG/M
3300016319\|Ga0182033_10285674	Not Available	1356	Open in IMG/M
3300016387\|Ga0182040_10515319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	957	Open in IMG/M
3300016404\|Ga0182037_10108551	All Organisms → cellular organisms → Bacteria	2014	Open in IMG/M
3300016404\|Ga0182037_10270596	All Organisms → cellular organisms → Bacteria	1353	Open in IMG/M
3300016404\|Ga0182037_10642013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	904	Open in IMG/M
3300016404\|Ga0182037_11545789	Not Available	589	Open in IMG/M
3300016404\|Ga0182037_12019890	Not Available	518	Open in IMG/M
3300016422\|Ga0182039_10099759	All Organisms → cellular organisms → Bacteria → Proteobacteria	2140	Open in IMG/M
3300021081\|Ga0210379_10124021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1086	Open in IMG/M
3300021560\|Ga0126371_10157520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2338	Open in IMG/M
3300028768\|Ga0307280_10216608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	681	Open in IMG/M
3300031545\|Ga0318541_10581712	Not Available	626	Open in IMG/M
3300031549\|Ga0318571_10232589	Not Available	671	Open in IMG/M
3300031561\|Ga0318528_10773248	Not Available	513	Open in IMG/M
3300031564\|Ga0318573_10169333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1151	Open in IMG/M
3300031564\|Ga0318573_10818752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	500	Open in IMG/M
3300031573\|Ga0310915_10357070	All Organisms → cellular organisms → Bacteria	1036	Open in IMG/M
3300031682\|Ga0318560_10345998	Not Available	803	Open in IMG/M
3300031744\|Ga0306918_11152466	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300031768\|Ga0318509_10617698	Not Available	603	Open in IMG/M
3300031768\|Ga0318509_10771197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	532	Open in IMG/M
3300031770\|Ga0318521_10141379	Not Available	1360	Open in IMG/M
3300031777\|Ga0318543_10276926	Not Available	749	Open in IMG/M
3300031781\|Ga0318547_10272264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1024	Open in IMG/M
3300031805\|Ga0318497_10678783	Not Available	578	Open in IMG/M
3300031833\|Ga0310917_10861883	Not Available	610	Open in IMG/M
3300031879\|Ga0306919_10004324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	7369	Open in IMG/M
3300031879\|Ga0306919_10413703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12	1035	Open in IMG/M
3300031879\|Ga0306919_10827984	Not Available	711	Open in IMG/M
3300031890\|Ga0306925_10149873	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2509	Open in IMG/M
3300031890\|Ga0306925_10408627	All Organisms → cellular organisms → Bacteria	1454	Open in IMG/M
3300031890\|Ga0306925_11677944	Not Available	614	Open in IMG/M
3300031890\|Ga0306925_12048034	Not Available	538	Open in IMG/M
3300031910\|Ga0306923_10123366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. B8	2941	Open in IMG/M
3300031912\|Ga0306921_10180134	Not Available	2477	Open in IMG/M
3300031912\|Ga0306921_11070725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	905	Open in IMG/M
3300031912\|Ga0306921_11340961	Not Available	789	Open in IMG/M
3300031912\|Ga0306921_11443888	Not Available	754	Open in IMG/M
3300031942\|Ga0310916_10266643	Not Available	1445	Open in IMG/M
3300031942\|Ga0310916_10467325	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300031946\|Ga0310910_11039126	Not Available	639	Open in IMG/M
3300031947\|Ga0310909_10093918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2401	Open in IMG/M
3300031954\|Ga0306926_10726513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1202	Open in IMG/M
3300031954\|Ga0306926_11409119	Not Available	808	Open in IMG/M
3300032001\|Ga0306922_10041488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4731	Open in IMG/M
3300032043\|Ga0318556_10455083	Not Available	669	Open in IMG/M
3300032051\|Ga0318532_10199876	Not Available	709	Open in IMG/M
3300032059\|Ga0318533_10117474	All Organisms → cellular organisms → Bacteria	1857	Open in IMG/M
3300032059\|Ga0318533_10123686	All Organisms → cellular organisms → Bacteria → Proteobacteria	1811	Open in IMG/M
3300032076\|Ga0306924_11898490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	617	Open in IMG/M
3300032076\|Ga0306924_12018143	Not Available	594	Open in IMG/M
3300032076\|Ga0306924_12360759	Not Available	537	Open in IMG/M
3300032076\|Ga0306924_12551532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C01	511	Open in IMG/M
3300032090\|Ga0318518_10678393	Not Available	524	Open in IMG/M
3300032091\|Ga0318577_10017716	Not Available	2913	Open in IMG/M
3300032091\|Ga0318577_10093592	All Organisms → cellular organisms → Bacteria	1401	Open in IMG/M
3300032094\|Ga0318540_10370240	Not Available	692	Open in IMG/M
3300032261\|Ga0306920_103490950	Not Available	581	Open in IMG/M
3300033289\|Ga0310914_11133445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683	Open in IMG/M

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.10%
Host-Associated	Host-Associated	1.90%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	96.19%
Aquatic	Environmental → Aquatic	1.90%
Plants	Host-Associated → Plants	1.90%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	96.19%
Freshwater	Environmental → Aquatic → Freshwater	0.95%
Sediment	Environmental → Aquatic → Sediment	0.95%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.95%
Roots	Host-Associated → Plants → Roots	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	79.05%
Loam	Environmental → Terrestrial → Soil → Loam	17.14%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.95%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.95%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	54.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.86%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	17.14%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.95%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.95%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.95%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.95%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F095754

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014871	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032043	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24	Environmental	Open in IMG/M
3300032051	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10216J12902_1167197002	3300000956	Soil	TGKLTRNVSVYGDASYLTSVSGESHIALKGNVGLRVTW*
Ga0066388_1012168724	3300005332	Tropical Forest Soil	RRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0066388_1032750961	3300005332	Tropical Forest Soil	ADPIQTRRNGNTTLEGGGGVTGKLARNVSVYGDASYLTSVSGESRITLKGNVGMRVTW*
Ga0066388_1056761932	3300005332	Tropical Forest Soil	EGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW*
Ga0008090_145380011	3300005363	Tropical Rainforest Soil	ADPIQTRRNGGTTLEGGGGITGKLARNVSVYGDASYLGSVSGEQRITLKGNVGMRVTW*
Ga0066905_1005112421	3300005713	Tropical Forest Soil	SNGFDTVTFNGFGIPTGRNGGTTLEGGGGVTGKLARNVSVYGDASYLSSVSGESRITLKGNVGMRVTW*
Ga0066905_1006840002	3300005713	Tropical Forest Soil	VTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW*
Ga0066905_1009744971	3300005713	Tropical Forest Soil	QRMVGVQWRRHLTFDGDGIRTRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0066905_1020030832	3300005713	Tropical Forest Soil	TGKLARNVSVYGDASYLSSVSGESRITLKGNVGLRVTW*
Ga0066905_1020089361	3300005713	Tropical Forest Soil	TLEGGGGVTGKLARNVSVYGDASYLSSVSGESRITLKGNVGMRVTW*
Ga0066905_1022168072	3300005713	Tropical Forest Soil	LEGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGVRVTW*
Ga0066903_1001922927	3300005764	Tropical Forest Soil	DTVTFDGVGIQTKRNGGTTLEGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGMRVTW*
Ga0066903_1004174533	3300005764	Tropical Forest Soil	GKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0066903_1045032871	3300005764	Tropical Forest Soil	GGVTGKLTRNISVYGDASYLTQVSGESRITLKGNVGMRVTW*
Ga0066903_1063409561	3300005764	Tropical Forest Soil	TGRNGGTTLEGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGMRVTW*
Ga0066903_1077268162	3300005764	Tropical Forest Soil	ITGKLTSNVGVYADASYLGSIAGEQRITIKGNAGVRVTW*
Ga0066903_1078973011	3300005764	Tropical Forest Soil	RNGNTTLEGGGGITGKLTRNVSVYGDASYLESVSGEQRITLKGNVGMRVTW*
Ga0066903_1082319271	3300005764	Tropical Forest Soil	NGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0066903_1088628662	3300005764	Tropical Forest Soil	GIQTKRNGGTTLEGGGGVTGKLARNVSIYGDASYLSQVSGESRITLKGNVGMRVTW*
Ga0066903_1089759451	3300005764	Tropical Forest Soil	GNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0075367_110522671	3300006178	Populus Endosphere	YLKGNVWWGSNGFDTVYFNSFGIPTGRNGGTTLEGGGGVTGKLTRNVSVYGDASYLTSVSGESRIALKGNVGMRVTW*
Ga0126382_101592161	3300010047	Tropical Forest Soil	LARNVSVYGDASYLESVSGEQRITLKGNVGVRVTW*
Ga0126373_110130421	3300010048	Tropical Forest Soil	PIQTRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0126376_130151221	3300010359	Tropical Forest Soil	TFDGVGIETKRNGGTTLEGGGGVTGKLTRNVGVYADASYLTSVSGESRITLKGNVGMRVTW*
Ga0126372_118448191	3300010360	Tropical Forest Soil	VYFNSFGIPTGRNGGTTLEGGGGVTGKLTRNVSVYGDASYLSSVSGEQRITLKGNVGMRVTW*
Ga0126378_108500061	3300010361	Tropical Forest Soil	GGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGMRVTW*
Ga0126378_111548162	3300010361	Tropical Forest Soil	MGTTLEGGGGVTGKLTRNVGVYADASYLTSVSGESRITLKGNVGMRVTW*
Ga0126378_119155472	3300010361	Tropical Forest Soil	GVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW*
Ga0126378_128058371	3300010361	Tropical Forest Soil	GGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGMRVTW*
Ga0126379_113240242	3300010366	Tropical Forest Soil	ITGKLARNVSVYGDASYLSSVSGESRITLKGNVGLRVTW*
Ga0126379_114492481	3300010366	Tropical Forest Soil	TGKLTRNVSVYGDASYLESVSGEQRITLKGNVGLRVTW*
Ga0126379_118251681	3300010366	Tropical Forest Soil	GKLARNVSIYGDASYLSQVSGESRITLKGNVGMRVTW*
Ga0126379_128848402	3300010366	Tropical Forest Soil	ARNVSIYGDASYLSQVSGESRITLKGNVGVRVTW*
Ga0126381_1005113222	3300010376	Tropical Forest Soil	LEGGGGVTGKLTRNVSVYGDASYLESVSGEQRITLKGNVGVRVTW*
Ga0126381_1005360096	3300010376	Tropical Forest Soil	GGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0126381_1015324712	3300010376	Tropical Forest Soil	GGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW*
Ga0126381_1035558631	3300010376	Tropical Forest Soil	TRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0126383_124214051	3300010398	Tropical Forest Soil	GTTLEGGGGVTGKLARNVSIYGDASYLSQVSGESRITLKGNVGARVTW*
Ga0126375_106641441	3300012948	Tropical Forest Soil	MLEGGGGVTGKLTRNVSVYGDASYLSSVSGESRIALKG
Ga0126375_109966921	3300012948	Tropical Forest Soil	IALEGGGGITGKLTSNVSVYGDASYLSSVSGESRITLKGNAGLRATW*
Ga0164302_113579832	3300012961	Soil	FDLPTERNGDTTLVGGGGVSGNLTRYVSVYADASYLGSVSGETRNTLKGNAGLRVTW*
Ga0126369_131696721	3300012971	Tropical Forest Soil	GGGVTGKLTHNVSVYGDASYLSQVSGESRITLKGNVGMRVTW*
Ga0126369_133509571	3300012971	Tropical Forest Soil	TLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW*
Ga0180095_11077911	3300014871	Soil	LTQSISVYADASYLSSVSGEQWIALKGNVGMRVTW*
Ga0132257_1034485292	3300015373	Arabidopsis Rhizosphere	TRNVSVYGDASYLTSVSGESRIALKGNVGLRVTW*
Ga0182033_101168101	3300016319	Soil	GVGIQTKRNGGTTLEGGGGVTGKLTRNISVYGDASYLTQVSGESLITLKGNVGMRVTW
Ga0182033_102856743	3300016319	Soil	LEGGGGVTGKLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0182040_105153191	3300016387	Soil	TTLEGGGGVTGKLTRNVSVYGDASYLESVSGEQRITLKGNVGMRVTW
Ga0182037_101085511	3300016404	Soil	TTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0182037_102705963	3300016404	Soil	EGGGGITGKLTRNISVYGDASYLTQVSGESLITLKGNVGMRVTW
Ga0182037_106420131	3300016404	Soil	GGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0182037_115457891	3300016404	Soil	GGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0182037_120198902	3300016404	Soil	GGVTGKLARNVSIYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0182039_100997591	3300016422	Soil	EGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGMRVTW
Ga0210379_101240211	3300021081	Groundwater Sediment	LVTFATTPVPVQRNHGTALEGGGGITGKLTQSISVYADASYLSSVSGEQWIALKGNVGMRVTW
Ga0126371_101575205	3300021560	Tropical Forest Soil	NTTLEGGGGITGKLARNVSVYGDASYLSSVSGESRITLKGNVGMRVTW
Ga0307280_102166082	3300028768	Soil	TFNGFGIPTGRNGGTTLEGGGGVAGKLTRNVSVYGDASYLTSVSGESRIALKGNVGLRVT
Ga0318541_105817121	3300031545	Soil	VPGGTTLEGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNV
Ga0318571_102325891	3300031549	Soil	LARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0318528_107732481	3300031561	Soil	LEGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0318573_101693331	3300031564	Soil	LTRNVSVYGDASYLESVSGEQRITLKGNVGMRVTW
Ga0318573_108187521	3300031564	Soil	FDGVGIQTKRNGGTTLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGARVTW
Ga0310915_103570701	3300031573	Soil	GGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0318560_103459981	3300031682	Soil	TLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGVRVTW
Ga0306918_111524663	3300031744	Soil	KLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0318509_106176981	3300031768	Soil	GGTTLEGGGGVTGKLARNVSIYGDASYLSQVSGESRITLKGNVGMRVTW
Ga0318509_107711971	3300031768	Soil	TTLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGARVTW
Ga0318521_101413792	3300031770	Soil	VPGGTTLEGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRV
Ga0318543_102769261	3300031777	Soil	KLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0318547_102722642	3300031781	Soil	GIQTGRNGGTTLEGGGGVTGKLTRNVSVYGDASYLESVSGEQRITLKGNVGMRVTW
Ga0318497_106787831	3300031805	Soil	VTGKLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0310917_108618831	3300031833	Soil	EGGAGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGVRVTW
Ga0306919_1000432419	3300031879	Soil	GKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0306919_104137031	3300031879	Soil	GTTLEGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGMRVTW
Ga0306919_108279841	3300031879	Soil	LEGGGGVTGKLARNVSIYGDASYLSQVSGESRITLKGNVGMRVTW
Ga0306925_101498734	3300031890	Soil	LEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306925_104086271	3300031890	Soil	KRNGGTTLEGGGGVTGKLTRNISVYGDASYLTQVSGESLITLKGNVGMRVTW
Ga0306925_116779441	3300031890	Soil	TGKLARNVSVYGDASYLESVSGEQRITLKGNVGVRVTW
Ga0306925_120480342	3300031890	Soil	KLARNVSVFGDASYLTSVSGESRITLKGNVGARVTW
Ga0306923_101233661	3300031910	Soil	GGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306921_101801341	3300031912	Soil	TLEGGGGVTGKLTRNVSIYGDASYLTQVSGESRITLKGNVGVRVTW
Ga0306921_110707251	3300031912	Soil	GGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0306921_113409611	3300031912	Soil	VTFDTDPIQTRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306921_114438883	3300031912	Soil	GVTGKLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0310916_102666431	3300031942	Soil	GGVTGKLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0310916_104673251	3300031942	Soil	VTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0310910_110391262	3300031946	Soil	IQTGRNGGTTLEGGGGVTGKLTRNVSVYGDASYLESVSGEQRITLKGNVGMRVTW
Ga0310909_100939181	3300031947	Soil	VTFDGVGIQTKRNGGTTLEGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGARVTW
Ga0306926_107265133	3300031954	Soil	QTKRNGGTTLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGARVTW
Ga0306926_114091192	3300031954	Soil	KLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306922_100414881	3300032001	Soil	GNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0318556_104550832	3300032043	Soil	QTRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0318532_101998761	3300032051	Soil	IQTGRNGGTTLEGGGGVTGKLARNVSVYGDASYLSQVSGESRITLKGNVGMRVTW
Ga0318533_101174744	3300032059	Soil	RNGGTTLEGGGGITGKLTRNISVYGDASYLTQVSGESLITLKGNVGMRVTW
Ga0318533_101236863	3300032059	Soil	IQTRRNGNTTLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306924_118984901	3300032076	Soil	TKRNGGTTLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGARVTW
Ga0306924_120181432	3300032076	Soil	LTRNIRVYGDASYLTQVSGESLITLKGNVGMRVTW
Ga0306924_123607591	3300032076	Soil	TLEGGGGITGKLARNVSVYGDASYLTSVSGESRITLKGNVGARVTW
Ga0306924_125515321	3300032076	Soil	GGTTLEGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGMRVTW
Ga0318518_106783931	3300032090	Soil	EGGGGVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGLRVTW
Ga0318577_100177161	3300032091	Soil	LARNVSVYGDASYLESVSGEQRITLRGNVGLRVTW
Ga0318577_100935921	3300032091	Soil	TTLEGGGGVTGKLARNVSIYGDASYLTQVSGESRITLKGNVGMRVTW
Ga0318540_103702401	3300032094	Soil	GVTGKLARNVSVYGDASYLESVSGEQRITLKGNVGVRVTW
Ga0306920_1034909501	3300032261	Soil	TGKLARNVSVYGDASYLSQVSGESRITLKGNVGVRVTW
Ga0310914_111334452	3300033289	Soil	TLEGGGGVTGKLTRNISIYGDASYLTQVSGESRITLKGNVGARVTW

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign