Basic Information | |
---|---|
Family ID | F095712 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 40 residues |
Representative Sequence | MLPACRTAGEGFAIPTFDVVPSDVEGFMEELWEFQ |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 91.35 % |
% of genes near scaffold ends (potentially truncated) | 80.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.48 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (25.714 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.190 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.190 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.46% β-sheet: 0.00% Coil/Unstructured: 82.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF13546 | DDE_5 | 7.62 |
PF13561 | adh_short_C2 | 1.90 |
PF00239 | Resolvase | 1.90 |
PF13613 | HTH_Tnp_4 | 1.90 |
PF00872 | Transposase_mut | 0.95 |
PF13473 | Cupredoxin_1 | 0.95 |
PF00589 | Phage_integrase | 0.95 |
PF01850 | PIN | 0.95 |
PF00144 | Beta-lactamase | 0.95 |
PF13551 | HTH_29 | 0.95 |
PF03631 | Virul_fac_BrkB | 0.95 |
PF13384 | HTH_23 | 0.95 |
PF12762 | DDE_Tnp_IS1595 | 0.95 |
PF08241 | Methyltransf_11 | 0.95 |
PF12974 | Phosphonate-bd | 0.95 |
PF07690 | MFS_1 | 0.95 |
PF02515 | CoA_transf_3 | 0.95 |
PF12728 | HTH_17 | 0.95 |
PF11295 | DUF3096 | 0.95 |
PF02371 | Transposase_20 | 0.95 |
PF03150 | CCP_MauG | 0.95 |
PF01609 | DDE_Tnp_1 | 0.95 |
PF13565 | HTH_32 | 0.95 |
PF00535 | Glycos_transf_2 | 0.95 |
PF13186 | SPASM | 0.95 |
PF13580 | SIS_2 | 0.95 |
PF07681 | DoxX | 0.95 |
PF00583 | Acetyltransf_1 | 0.95 |
PF00496 | SBP_bac_5 | 0.95 |
PF00501 | AMP-binding | 0.95 |
PF13191 | AAA_16 | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.90 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.90 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.95 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.95 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.95 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.95 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.95 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.95 |
COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.95 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.10 % |
Unclassified | root | N/A | 41.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100322770 | Not Available | 502 | Open in IMG/M |
3300002912|JGI25386J43895_10084575 | Not Available | 843 | Open in IMG/M |
3300004633|Ga0066395_10467943 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005332|Ga0066388_101266657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1267 | Open in IMG/M |
3300005332|Ga0066388_105152270 | Not Available | 663 | Open in IMG/M |
3300005554|Ga0066661_10602082 | Not Available | 652 | Open in IMG/M |
3300005555|Ga0066692_10888734 | Not Available | 546 | Open in IMG/M |
3300005562|Ga0058697_10609863 | Not Available | 571 | Open in IMG/M |
3300005574|Ga0066694_10269497 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005764|Ga0066903_100158421 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
3300005764|Ga0066903_100158449 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
3300005764|Ga0066903_101203822 | Not Available | 1407 | Open in IMG/M |
3300005764|Ga0066903_101830959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1160 | Open in IMG/M |
3300005764|Ga0066903_103047425 | Not Available | 907 | Open in IMG/M |
3300005764|Ga0066903_103162942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 891 | Open in IMG/M |
3300005764|Ga0066903_103466818 | Not Available | 850 | Open in IMG/M |
3300005764|Ga0066903_107298887 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Latescibacteria bacterium SCGC AAA252-D10 | 571 | Open in IMG/M |
3300005981|Ga0081538_10300145 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Latescibacteria bacterium SCGC AAA252-D10 | 590 | Open in IMG/M |
3300006196|Ga0075422_10274389 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300006800|Ga0066660_11460721 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300006844|Ga0075428_100085040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3450 | Open in IMG/M |
3300006845|Ga0075421_100412175 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300006845|Ga0075421_100533136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1390 | Open in IMG/M |
3300006846|Ga0075430_100221838 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300006854|Ga0075425_100746556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G9 | 1123 | Open in IMG/M |
3300006876|Ga0079217_10511191 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300006969|Ga0075419_10315044 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
3300006969|Ga0075419_10913832 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300007004|Ga0079218_13796916 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009038|Ga0099829_11422867 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae | 573 | Open in IMG/M |
3300009090|Ga0099827_10338818 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300009100|Ga0075418_12526460 | Not Available | 561 | Open in IMG/M |
3300009147|Ga0114129_12215253 | Not Available | 661 | Open in IMG/M |
3300009156|Ga0111538_12048609 | Not Available | 719 | Open in IMG/M |
3300009691|Ga0114944_1171861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 857 | Open in IMG/M |
3300010043|Ga0126380_10008418 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 4510 | Open in IMG/M |
3300010044|Ga0126310_11610532 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300010046|Ga0126384_10635519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 939 | Open in IMG/M |
3300010046|Ga0126384_10955467 | Not Available | 777 | Open in IMG/M |
3300010047|Ga0126382_10043591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 2573 | Open in IMG/M |
3300010048|Ga0126373_10135646 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300010322|Ga0134084_10341935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
3300010359|Ga0126376_10450316 | Not Available | 1176 | Open in IMG/M |
3300010359|Ga0126376_10808731 | Not Available | 916 | Open in IMG/M |
3300010359|Ga0126376_12028256 | Not Available | 618 | Open in IMG/M |
3300010360|Ga0126372_11681340 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300010360|Ga0126372_12535597 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300010361|Ga0126378_10716398 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300010366|Ga0126379_10132557 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 2287 | Open in IMG/M |
3300010366|Ga0126379_10587772 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300010366|Ga0126379_12664989 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010366|Ga0126379_12910697 | Not Available | 573 | Open in IMG/M |
3300010366|Ga0126379_13405243 | Not Available | 533 | Open in IMG/M |
3300010398|Ga0126383_10807314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
3300010398|Ga0126383_12099037 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012285|Ga0137370_10157844 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300012350|Ga0137372_11169229 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300012356|Ga0137371_10623219 | Not Available | 828 | Open in IMG/M |
3300012362|Ga0137361_10943659 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300012407|Ga0134050_1012545 | Not Available | 598 | Open in IMG/M |
3300012929|Ga0137404_11005583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 763 | Open in IMG/M |
3300012948|Ga0126375_10922968 | Not Available | 704 | Open in IMG/M |
3300012948|Ga0126375_11368810 | Not Available | 598 | Open in IMG/M |
3300012948|Ga0126375_11441249 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012971|Ga0126369_10868473 | Not Available | 986 | Open in IMG/M |
3300012971|Ga0126369_12332878 | Not Available | 621 | Open in IMG/M |
3300012971|Ga0126369_12761866 | Not Available | 574 | Open in IMG/M |
3300012971|Ga0126369_13533728 | Not Available | 512 | Open in IMG/M |
3300012971|Ga0126369_13690044 | Not Available | 502 | Open in IMG/M |
3300014487|Ga0182000_10603435 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300015373|Ga0132257_102010521 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300016319|Ga0182033_10839656 | Not Available | 811 | Open in IMG/M |
3300016387|Ga0182040_11744294 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300018084|Ga0184629_10662339 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria | 528 | Open in IMG/M |
3300018468|Ga0066662_11697559 | Not Available | 660 | Open in IMG/M |
3300021560|Ga0126371_10349186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1614 | Open in IMG/M |
3300025149|Ga0209827_10128843 | Not Available | 1732 | Open in IMG/M |
3300025910|Ga0207684_10874818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300027379|Ga0209842_1055459 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300027750|Ga0209461_10052231 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300027821|Ga0209811_10051195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1412 | Open in IMG/M |
3300027873|Ga0209814_10195366 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300027875|Ga0209283_10099340 | Not Available | 1903 | Open in IMG/M |
3300027880|Ga0209481_10033672 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
3300027880|Ga0209481_10122603 | Not Available | 1268 | Open in IMG/M |
3300027909|Ga0209382_11053890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 843 | Open in IMG/M |
3300028889|Ga0247827_10876917 | Not Available | 601 | Open in IMG/M |
3300031231|Ga0170824_128772252 | Not Available | 722 | Open in IMG/M |
3300031545|Ga0318541_10628955 | Not Available | 600 | Open in IMG/M |
3300031681|Ga0318572_10527370 | Not Available | 704 | Open in IMG/M |
3300031681|Ga0318572_10728192 | Not Available | 590 | Open in IMG/M |
3300031744|Ga0306918_10664905 | Not Available | 815 | Open in IMG/M |
3300031893|Ga0318536_10153793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1169 | Open in IMG/M |
3300031947|Ga0310909_11211069 | Not Available | 610 | Open in IMG/M |
3300031954|Ga0306926_10478582 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300031954|Ga0306926_12536815 | Not Available | 561 | Open in IMG/M |
3300032003|Ga0310897_10637557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300032013|Ga0310906_11048521 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300032013|Ga0310906_11112921 | Not Available | 572 | Open in IMG/M |
3300032017|Ga0310899_10030731 | Not Available | 1830 | Open in IMG/M |
3300032261|Ga0306920_101163862 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia plasticadhaerens | 1116 | Open in IMG/M |
3300033289|Ga0310914_10970560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 750 | Open in IMG/M |
3300034664|Ga0314786_002663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae | 2083 | Open in IMG/M |
3300034678|Ga0314803_077434 | Not Available | 620 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 25.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.95% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1003227701 | 3300000364 | Soil | MLPVCRTEGEGFSIPTFDMVPSDVDGFMDELQEFQSAFH |
JGI25386J43895_100845752 | 3300002912 | Grasslands Soil | MLPACRTGGEGFAIPTFDLVPNDVEGFMEELWEFQSAFHDC |
Ga0066395_104679431 | 3300004633 | Tropical Forest Soil | TKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP* |
Ga0066388_1012666571 | 3300005332 | Tropical Forest Soil | MLPACRTAGEGFAIPAFDVVPSDVEGFMEELWEFQATFHD |
Ga0066388_1051522701 | 3300005332 | Tropical Forest Soil | MLPACRTSGEGFAIPTFDLVPSDVEGFMEELWEFQSTFHDC |
Ga0066661_106020823 | 3300005554 | Soil | MLPACRTEGAGFSMPTFDLVPSDVEGFMDELWEFQ |
Ga0066692_108887341 | 3300005555 | Soil | MLPIGRTEGEGFAIPTFDVVPSDVEGFMDALWEFQSAFHDCF |
Ga0058697_106098632 | 3300005562 | Agave | MLPACRSQGDEFTIPTFDIVPRDVEGFMDELWEFQ |
Ga0066694_102694972 | 3300005574 | Soil | MLPACRTAGEGFAIPTFDIVPSDVEGFLEELWEFQS |
Ga0066903_1001584213 | 3300005764 | Tropical Forest Soil | MLPACRTEGEGFTMPTLDFVPSDVEGLMDELWEFQSTFHDCFTQSGPTP* |
Ga0066903_1001584495 | 3300005764 | Tropical Forest Soil | MLPACRTAGEGFAIPTFEVVPSDVEGFIDELWEFQEAFHGPRRSD* |
Ga0066903_1012038222 | 3300005764 | Tropical Forest Soil | MLPACRTVNEGFAIPTFDLTPPNVEGFLEELWGD* |
Ga0066903_1018309592 | 3300005764 | Tropical Forest Soil | MLPACRIDGEGFAIPTFAVVPSDVEAFMDALWEFQSRFHDCDVYD* |
Ga0066903_1030474251 | 3300005764 | Tropical Forest Soil | MLPACRIGGEGFAIPTFDLVPSDVEGFMEELWAFQST |
Ga0066903_1031629421 | 3300005764 | Tropical Forest Soil | MLPTCRTEGAGFALPTFDVVPSDVGGFMDELQEFQSAFHDC |
Ga0066903_1034668181 | 3300005764 | Tropical Forest Soil | MLPACRIGGEGFAIPTFDLVPSDVEGFMEELWAFQ |
Ga0066903_1072988871 | 3300005764 | Tropical Forest Soil | MLPRCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVF |
Ga0081538_103001451 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLPACRTAGEGFAIPTFDLVPCDIEGFMDELWKFQSAFHDCFT |
Ga0075422_102743891 | 3300006196 | Populus Rhizosphere | MLPACRTAGEGFAISTFDLVPSDVEGFLEELWEFQ |
Ga0066660_114607211 | 3300006800 | Soil | MLPACRTGGEGFAIPTFDLVPSDVEGFMEELWAFQSIFHDC |
Ga0075428_1000850404 | 3300006844 | Populus Rhizosphere | MIPACRTEGDGFAIPIFDLTPRDVAGFTNELQEFQGLFHDCFSPE* |
Ga0075421_1004121751 | 3300006845 | Populus Rhizosphere | MLPACRTEGDGFAIPTFDVLPSDVEGFMDELRTFQSAF |
Ga0075421_1005331363 | 3300006845 | Populus Rhizosphere | MLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQ |
Ga0075430_1002218382 | 3300006846 | Populus Rhizosphere | MLPACRTAGEGFAIPTCDVVPSDVEGFMEELWEFQATFHD |
Ga0075425_1007465562 | 3300006854 | Populus Rhizosphere | MLPACRTAGEGFAIPTFDVVPSDVEGVLEALWEFQSTLHDCFAR |
Ga0079217_105111911 | 3300006876 | Agricultural Soil | MLPACRTAGDGFTIPKFTLDPSDVEGFMDELHGFHTAFRDCF |
Ga0075419_103150442 | 3300006969 | Populus Rhizosphere | MLPACRIDGEGFAIPAFEVVPSDVEGCMDALWEFQSLLHDCDVYD* |
Ga0075419_109138321 | 3300006969 | Populus Rhizosphere | MLPRCRTAGEPFVIPTFDVQVSDVEGCMDELQEFQSVF |
Ga0079218_137969161 | 3300007004 | Agricultural Soil | MLPACRTPGEGFAIPAFDVVPSDVEGFMEELWEFQ |
Ga0066710_1020585252 | 3300009012 | Grasslands Soil | MFPACRTAGDECAIPPFDLPPRDVAGVTDALQEFQGLLHDCFP |
Ga0099829_114228673 | 3300009038 | Vadose Zone Soil | MLPACQTAGEGFVIPTFDLVPSDREGFMDALGEFQPLFRV |
Ga0099827_103388181 | 3300009090 | Vadose Zone Soil | MLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQSV |
Ga0075418_125264601 | 3300009100 | Populus Rhizosphere | MLPVCRTAGEGFAIPTFDLVPSDVEGFMEELWEFQSAFHDCFA |
Ga0114129_122152532 | 3300009147 | Populus Rhizosphere | MLPACRTDHAGYSLPRFDFVPRAVEGFMGALGEFQSAC |
Ga0111538_120486091 | 3300009156 | Populus Rhizosphere | RTNGEGFTIPPFDLVPSDVEGFMDALWEFQSAFHDCFARSG* |
Ga0114944_11718611 | 3300009691 | Thermal Springs | MLAACRTSGEGFAIPTFDLVPSDVEGFMEELWEFQ |
Ga0126380_100084185 | 3300010043 | Tropical Forest Soil | MLPACRTDNEGFALPTFDLTPPDVEGFLEELWECPSAFHD |
Ga0126310_116105322 | 3300010044 | Serpentine Soil | MLPRCRTAGEPFAIPTFDVQVSDVAGFMDELQTCQSLFHDCFA |
Ga0126384_106355191 | 3300010046 | Tropical Forest Soil | MLPRCRTADEPFVMPPFDVQGSDVEGFIDELQEFQSLFHDCCARS |
Ga0126384_109554671 | 3300010046 | Tropical Forest Soil | MRQKMLPACRIDGEGFAIPTFEGVPSDVEGCMDALWAFQSLLHDCDVYD* |
Ga0126382_100435914 | 3300010047 | Tropical Forest Soil | MLPACRTVNEGFAIPTFDLTPLDVEGFLEELWGD* |
Ga0126373_101356461 | 3300010048 | Tropical Forest Soil | MLPACRTAGEGFALPTFEVVPSDVEGFMEELWEFQSAQ* |
Ga0134084_103419351 | 3300010322 | Grasslands Soil | MLPIGRTEGEGFAIPTFDVVPSDVEGFMDALWEFQSAFHDC |
Ga0126376_104503163 | 3300010359 | Tropical Forest Soil | MLPACRTASGGFAIPIFDLTPLDVEGFLEELWEFQSNF |
Ga0126376_108087311 | 3300010359 | Tropical Forest Soil | MLPACRTVNEGLAIPTFDLTPPDGEGFLEELWGD* |
Ga0126376_120282561 | 3300010359 | Tropical Forest Soil | MLPACRTPDETFTIPMFDVLPGDVEGLVEELWEFQAAF |
Ga0126372_116813401 | 3300010360 | Tropical Forest Soil | MLPACRTTGDEFTIPTFELTPRDVAEFTDELQEFQ |
Ga0126372_125355972 | 3300010360 | Tropical Forest Soil | MHRHRRGRRLPAGRTAGDECVLPPFALTPRDVAGFTDELQEFQGLF |
Ga0126378_107163981 | 3300010361 | Tropical Forest Soil | SRRPHMLPACRTKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP* |
Ga0126379_101325574 | 3300010366 | Tropical Forest Soil | MLPACRTDGDRFTMLTFDLVPSDVDGFMDATFHE* |
Ga0126379_105877722 | 3300010366 | Tropical Forest Soil | MLPACRTKGEGFTMPTLGLVPSDVEGLMDELWEFQSTFHDCFTQSGPTP* |
Ga0126379_126649892 | 3300010366 | Tropical Forest Soil | MLPACRTAGEGFAIPTFDVVPSDVEGFMEELWEFQ |
Ga0126379_129106972 | 3300010366 | Tropical Forest Soil | MLPACRAAAEGFTIPHFGVVPSDVTGFMEELWEFQSVFHDCFVRSES |
Ga0126379_134052431 | 3300010366 | Tropical Forest Soil | MLPACRIASEGFAIPTFDLTPPDVEGLLEELWEFQ |
Ga0126383_108073142 | 3300010398 | Tropical Forest Soil | MLPACRTDEVTYTIPTFDVVPSDVEGFMDELWACQAAL |
Ga0126383_120990371 | 3300010398 | Tropical Forest Soil | MLPACRTAGEGFAIPTFEVVPSDVEGFMEELWEFQSAC |
Ga0137370_101578443 | 3300012285 | Vadose Zone Soil | MLPACRTEGEGFAIPTFDVVPSDVEGFMDELQEFHRLLTRFGEY* |
Ga0137372_111692293 | 3300012350 | Vadose Zone Soil | MLPVCRTIGEGLSIPTFDLAPSDVEGFMDELQEFQ |
Ga0137371_106232193 | 3300012356 | Vadose Zone Soil | MLPACRTAGDEFAIPPFDLTPRDVAGFTDALQEFQGLCH |
Ga0137361_109436591 | 3300012362 | Vadose Zone Soil | MLPVGRTEGEGFSIPTFDVVPSDVEGFMDELQAFQSA |
Ga0134050_10125451 | 3300012407 | Grasslands Soil | MLPRCRTAGKPFVIPTFDVQVSDVEGFMDELQEFQ |
Ga0137404_110055831 | 3300012929 | Vadose Zone Soil | MLPACRTEGEGFAMPTFDVVPSDVEGFMDELQECQSA |
Ga0126375_109229681 | 3300012948 | Tropical Forest Soil | MLPRCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVFHDCF |
Ga0126375_113688101 | 3300012948 | Tropical Forest Soil | MLPVCRTAGDGFAIPPFDLTPRDVTGFTDELQEFQGLF |
Ga0126375_114412492 | 3300012948 | Tropical Forest Soil | MLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQ |
Ga0126369_108684732 | 3300012971 | Tropical Forest Soil | MLPACRTAGDEFAIPTFELTPRDVAEFTDALQEFQ |
Ga0126369_123328781 | 3300012971 | Tropical Forest Soil | MLPVCRTASEGFAIPTFDLVPSDVEGFLEELWEFPSAFHDCFA |
Ga0126369_127618661 | 3300012971 | Tropical Forest Soil | MLPACRTAGEAFAIPTFDVTPRAVEGFMEEWWEFQAAFQALN* |
Ga0126369_135337282 | 3300012971 | Tropical Forest Soil | MLPACRTAGEGFAIPAFDVVPSAVEGFLEELWEF* |
Ga0126369_136900441 | 3300012971 | Tropical Forest Soil | MLPHCRTVGEPFVIPTFDVQVSDVEGFMDELQEFQSVFHDCF |
Ga0182000_106034352 | 3300014487 | Soil | MLPRCRTAGEPFVIPTFDVQVSDVEGFMDELQEFQSVFH |
Ga0132257_1020105212 | 3300015373 | Arabidopsis Rhizosphere | MLPACRTDNEGFAIPTFDLTPPDVEGFLETLWEFQSAFHDCFP |
Ga0182033_108396561 | 3300016319 | Soil | MLPRCRTAGEPFVIPPFDVQVSDVEGFMDEVQTFQSVFHDCF |
Ga0182040_117442941 | 3300016387 | Soil | MLPACRTNGEGFTIPTFDLVPSDVEGFMEELWAFQ |
Ga0184629_106623391 | 3300018084 | Groundwater Sediment | MLPACRTDGEGFTIPTFDVVSSDVEGFMDELWEFQSAFHDC |
Ga0066662_116975591 | 3300018468 | Grasslands Soil | MLPACRTAGDECAISPFDLPPRDVAGVTDALQEFQGLLHD |
Ga0126371_103491862 | 3300021560 | Tropical Forest Soil | MLPACRTGGEGFAIPTFDLAPSDVEGFMEELWEFQS |
Ga0209827_101288432 | 3300025149 | Thermal Springs | MLPACRTADEGFSIPTFDVVPRDVEGFMDALQECPSAFHDLIG |
Ga0207684_108748181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPACRTDGEGFSIPTFDVVPSDVEGFMEALWEFQST |
Ga0209842_10554592 | 3300027379 | Groundwater Sand | IIRRQRMLPIGRTEGEGCAIPTFDVVPSDVEGFMDALWEFQ |
Ga0209461_100522311 | 3300027750 | Agave | MLPRCRTVGEPFVIPPFDVQVSDVEGFMDELQEFQSVF |
Ga0209811_100511951 | 3300027821 | Surface Soil | MLPACRTAGNGFAIPTFDLTPGDVAGFIDELQEFQGL |
Ga0209814_101953662 | 3300027873 | Populus Rhizosphere | MLPACRTDHEGFTIPTFDLVPSDVEGFMAELWEFQSAFHDCFT |
Ga0209283_100993401 | 3300027875 | Vadose Zone Soil | MLPACRTEGEGFAIPTFDVVPSDVEGFMDALQEFQ |
Ga0209481_100336724 | 3300027880 | Populus Rhizosphere | MIPACRTEGDGFAIPIFDLTPRDVAGFTNELQEFQGLFHDCFSPE |
Ga0209481_101226033 | 3300027880 | Populus Rhizosphere | MLPACRIDGEGFAIPAFEVVPSDVEGCMDALWEFQSLLHDCDVYD |
Ga0209382_110538901 | 3300027909 | Populus Rhizosphere | MLPACRTAGEGFAISTFDLVPSDVEGFLEALWEFQ |
Ga0247827_108769171 | 3300028889 | Soil | MLPACRTEGAGFSLPPFDLVPSDVEGFMDELWEFQSTFHDCCARSEPRL |
Ga0170824_1287722522 | 3300031231 | Forest Soil | PACRTDHEGFTIPTFDRVPRAVEGFMDALWECQSALHDCCARSEPRVHFFD |
Ga0318541_106289552 | 3300031545 | Soil | MLPRCRTAGEPFVMPTFAVQVSDVEGFMDELQAFQ |
Ga0318572_105273702 | 3300031681 | Soil | MLPACRTAGEGLALPTFEVVPSDVAGFMEELWEFQSAFHD |
Ga0318572_107281921 | 3300031681 | Soil | MSPACRIDGGGFTIPTFDLVPRDVEGFMDELWEFQAAVHDCFTRSEPRAHF |
Ga0306918_106649051 | 3300031744 | Soil | MLPARRTSGEGFTIPTFDLVPSDVEGFMDALWEFQSAFHDCFAR |
Ga0318536_101537931 | 3300031893 | Soil | RTAGEPFVIPPFDVQVSDVEGFMDELQTFQSVFHD |
Ga0310909_112110691 | 3300031947 | Soil | MLPARRTSGEGFTIPTFDLVPSDVEGFMDALWEFQ |
Ga0306926_104785823 | 3300031954 | Soil | MSPACRIDGGGFTIPTFDLVPRDVEGFMDELWEFQAAVHD |
Ga0306926_125368152 | 3300031954 | Soil | MLPACRTASEGFAIATFDLVPSDVEGFLEELWEFPSAFHDCFAPQ |
Ga0310897_106375571 | 3300032003 | Soil | MLPACRTGGEGFAIPTFDLVPNDVEGFMEELWEFQSAFHDCFA |
Ga0310906_110485211 | 3300032013 | Soil | MLPACRTAGEGFAIPTFDVVPSDVEGFLEERWELQSTF |
Ga0310906_111129211 | 3300032013 | Soil | MLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQSVFHD |
Ga0310899_100307312 | 3300032017 | Soil | MLPACRTAGESFAIPTFDVVPSDVEGFMEELWEFQ |
Ga0306920_1011638621 | 3300032261 | Soil | MLPACRTDEATYTIPTFDIVPGDVEGFMDELWEFQ |
Ga0310914_109705601 | 3300033289 | Soil | MLPRCRTAGEPFVIPTFDVQVRDVEGFMDELQEFQG |
Ga0314786_002663_14_136 | 3300034664 | Soil | MLPACRTNGEGFTIPTFDIVPSDVEGFMDELWEFQSAFHD |
Ga0314803_077434_504_620 | 3300034678 | Soil | MLPACRTAGEGIAIPTFDLAPRDVEGFMEELWEFQAAFH |
⦗Top⦘ |