Basic Information | |
---|---|
Family ID | F095663 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 48 residues |
Representative Sequence | RYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.95 % |
% of genes near scaffold ends (potentially truncated) | 96.19 % |
% of genes from short scaffolds (< 2000 bps) | 95.24 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.74 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.238 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.619 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 22.37% Coil/Unstructured: 52.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.74 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
d.144.1.0: automated matches | d3fe3a_ | 3fe3 | 0.73044 |
d.144.1.0: automated matches | d3hmoa_ | 3hmo | 0.72176 |
d.58.18.14: TM1266-like | d2nzca1 | 2nzc | 0.70958 |
d.144.1.0: automated matches | d4b9da1 | 4b9d | 0.68957 |
d.139.1.1: PurM C-terminal domain-like | d1t3ta7 | 1t3t | 0.67171 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF03706 | LPG_synthase_TM | 57.14 |
PF07519 | Tannase | 1.90 |
PF12072 | RNase_Y_N | 0.95 |
PF00206 | Lyase_1 | 0.95 |
PF05635 | 23S_rRNA_IVP | 0.95 |
PF00165 | HTH_AraC | 0.95 |
PF13396 | PLDc_N | 0.95 |
PF13472 | Lipase_GDSL_2 | 0.95 |
PF13649 | Methyltransf_25 | 0.95 |
PF13579 | Glyco_trans_4_4 | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 57.14 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.14 % |
Unclassified | root | N/A | 2.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS401AMZGZ | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005178|Ga0066688_10344632 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005332|Ga0066388_102876853 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005332|Ga0066388_104019106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300005334|Ga0068869_100271997 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300005335|Ga0070666_11231414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005355|Ga0070671_101694496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300005367|Ga0070667_100814307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300005467|Ga0070706_101524783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300005467|Ga0070706_101877753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300005563|Ga0068855_100482092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
3300005586|Ga0066691_10356088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300005615|Ga0070702_101568259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300005617|Ga0068859_101747767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300005617|Ga0068859_102049939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300005617|Ga0068859_102656653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300005618|Ga0068864_100980313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300005618|Ga0068864_102627305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300005719|Ga0068861_101261951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300005764|Ga0066903_104564280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300005834|Ga0068851_11005366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300006047|Ga0075024_100520942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300006237|Ga0097621_100353970 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300006914|Ga0075436_100570764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
3300006953|Ga0074063_13135374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300006954|Ga0079219_10548357 | Not Available | 828 | Open in IMG/M |
3300007076|Ga0075435_100489696 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300007265|Ga0099794_10653975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300009012|Ga0066710_100071208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4463 | Open in IMG/M |
3300009012|Ga0066710_101576922 | Not Available | 1008 | Open in IMG/M |
3300009012|Ga0066710_102359088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300009089|Ga0099828_10812965 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300009090|Ga0099827_10549242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
3300009094|Ga0111539_13446355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300009143|Ga0099792_10745477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300009148|Ga0105243_11547849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300009156|Ga0111538_10771858 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300009177|Ga0105248_10249974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1996 | Open in IMG/M |
3300009545|Ga0105237_12762349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300010040|Ga0126308_10758024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300010047|Ga0126382_12157717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300010362|Ga0126377_11066384 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300010362|Ga0126377_12883561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300012096|Ga0137389_10513382 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300012206|Ga0137380_10027789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 5210 | Open in IMG/M |
3300012349|Ga0137387_11010318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300012355|Ga0137369_11020329 | Not Available | 547 | Open in IMG/M |
3300012469|Ga0150984_111887599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300012918|Ga0137396_10194071 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300012924|Ga0137413_10887471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300012951|Ga0164300_10207703 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300012985|Ga0164308_10548169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300013297|Ga0157378_12408659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300013308|Ga0157375_10843104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
3300013308|Ga0157375_12949294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300015241|Ga0137418_11107596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300015242|Ga0137412_10663960 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300015242|Ga0137412_10995310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300015264|Ga0137403_10974421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300015356|Ga0134073_10199539 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300015372|Ga0132256_103289859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300015373|Ga0132257_102806117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300016371|Ga0182034_11600384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300018083|Ga0184628_10565046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300018476|Ga0190274_13281769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300018482|Ga0066669_10937573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300020000|Ga0193692_1033623 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300020034|Ga0193753_10220933 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300021377|Ga0213874_10259177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300024224|Ga0247673_1058249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300025315|Ga0207697_10443090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300025903|Ga0207680_10510312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
3300025908|Ga0207643_10325368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
3300025914|Ga0207671_10716943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300025918|Ga0207662_10733916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300025934|Ga0207686_10200635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1428 | Open in IMG/M |
3300025935|Ga0207709_10537138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
3300025941|Ga0207711_11643344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300026035|Ga0207703_11738268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300026088|Ga0207641_10062168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3186 | Open in IMG/M |
3300026089|Ga0207648_10201143 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300026089|Ga0207648_10504264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300026331|Ga0209267_1149232 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300026523|Ga0209808_1185350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300026555|Ga0179593_1232146 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300027512|Ga0209179_1153231 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300028381|Ga0268264_10522488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300028381|Ga0268264_11720885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300028768|Ga0307280_10373666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300028828|Ga0307312_10260297 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300028881|Ga0307277_10169520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300028881|Ga0307277_10436858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300031231|Ga0170824_113314581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300031366|Ga0307506_10518331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300031545|Ga0318541_10660122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300031616|Ga0307508_10669158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300031679|Ga0318561_10052856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2038 | Open in IMG/M |
3300031724|Ga0318500_10387282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300031740|Ga0307468_101063772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300031779|Ga0318566_10236123 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300031831|Ga0318564_10312018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300031893|Ga0318536_10566457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300032065|Ga0318513_10242909 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300032342|Ga0315286_11926153 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300033004|Ga0335084_10699506 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.95% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_08192160 | 2189573004 | Grass Soil | VETLKFFPRRDAFKILEPNKVRYAVIHLYGYNEDDRRAELARLKEFSQYLKPLYDDSFTQLYEIVGFPP |
Ga0066688_103446321 | 3300005178 | Soil | YAVFHRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR* |
Ga0066388_1028768531 | 3300005332 | Tropical Forest Soil | VRYAVFHMYGYNASNRSDVEVRLKQLEKYFRLLYEGEGTRLYEIVGYPP* |
Ga0066388_1040191062 | 3300005332 | Tropical Forest Soil | HMYGYNESNRQDVITRLDQLQSHFRLLYEGEGTRLYEILSYPPEK* |
Ga0068869_1002719972 | 3300005334 | Miscanthus Rhizosphere | HMNGYNTENRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP* |
Ga0070666_112314142 | 3300005335 | Switchgrass Rhizosphere | VRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP* |
Ga0070671_1016944962 | 3300005355 | Switchgrass Rhizosphere | FHMNGYNTENRTDVMTRLKEFEPYLRPLYTDEWTRLYEIVGFPP* |
Ga0070667_1008143071 | 3300005367 | Switchgrass Rhizosphere | YGYNASNRADVIGRLKEFEPYLRPLYVDDQTRLYEIIGFPP* |
Ga0070706_1015247832 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YWFNDENWQDVLTRLKTAEPYMRLLYDGEGTQLYEVVGFPP* |
Ga0070706_1018777532 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HMDWYNIENRKDVVGRLKEFAPYLRLIYADHATRLYEIVGFPR* |
Ga0068855_1004820923 | 3300005563 | Corn Rhizosphere | TENRTDVLTRLKEFEPYLRPLYMDEWTRLYEIVGFPP* |
Ga0066691_103560881 | 3300005586 | Soil | LLEPLHIRYAVFHMHWYNVENQNDVIGRLKQFAPYLRLIYADRSTRLYEIVGFPR* |
Ga0070702_1015682591 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP* |
Ga0068859_1017477671 | 3300005617 | Switchgrass Rhizosphere | GYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP* |
Ga0068859_1020499391 | 3300005617 | Switchgrass Rhizosphere | RYAVFHMNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR* |
Ga0068859_1026566532 | 3300005617 | Switchgrass Rhizosphere | AVLHMYGYNASNRADVIGRLKEFEPYLRPLYVDDQTRLYEIIGFPP* |
Ga0068864_1009803132 | 3300005618 | Switchgrass Rhizosphere | GYNTENRNDVLTRLEEFKAYLRPLYADETTRLYEIVGFPR* |
Ga0068864_1026273052 | 3300005618 | Switchgrass Rhizosphere | VRYAMFHMYGYNAENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP* |
Ga0068861_1012619512 | 3300005719 | Switchgrass Rhizosphere | MYGYNAANRADVVGRLKEFEAYLRPLYVDDQTRLYEIIGFPP* |
Ga0066903_1045642802 | 3300005764 | Tropical Forest Soil | YAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFPK* |
Ga0068851_110053661 | 3300005834 | Corn Rhizosphere | GYNTENRNDVLARLKEFEPYLRPLYMDETTRLYEIVGFPP* |
Ga0075024_1005209422 | 3300006047 | Watersheds | AVFHMNGYNTENRNDVLTRLKEFERYLRPLYADDTTRLYEIVGFPP* |
Ga0097621_1003539702 | 3300006237 | Miscanthus Rhizosphere | NRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP* |
Ga0075436_1005707641 | 3300006914 | Populus Rhizosphere | WYNDPNWGDVVARLKEFEPYVRQLYDGENTRLYEIVGSPP* |
Ga0074063_131353742 | 3300006953 | Soil | LEPGRVRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDDGTRLYEIVGFPP* |
Ga0079219_105483572 | 3300006954 | Agricultural Soil | MKLIEPWKVRYAIFHMGGYNEPNRRDTELRLKQLESYFRPLYVSDTTRLYEIVGFPP* |
Ga0075435_1004896961 | 3300007076 | Populus Rhizosphere | YWYNDENWRDVTTRLKEFHPYLRRLYEDEGTRLYEIVGAPK* |
Ga0099794_106539752 | 3300007265 | Vadose Zone Soil | WYNHENWRDVTARLKEFDAYLKPLYKDEGTRLYEIVGFPP* |
Ga0066710_1000712085 | 3300009012 | Grasslands Soil | YNTENRNDVLGRLKEFAPYLRQLYVDDETQLYEIIGYPP |
Ga0066710_1015769222 | 3300009012 | Grasslands Soil | YWYNSENQRDVLTRLKELEPYFRPLYIDADTRLYEIVGYPH |
Ga0066710_1023590881 | 3300009012 | Grasslands Soil | VRYAIFHMYGYNAQNRSEVLGRLKRFTEYLRPIYMTEDTRLYEIVGFPP |
Ga0099828_108129651 | 3300009089 | Vadose Zone Soil | ENWQDVLTRLKNAEPYMRLLYDGEGTRLYEIVGFPP* |
Ga0099827_105492421 | 3300009090 | Vadose Zone Soil | ALKILEPNGVRYAVFHMYGFNTENRHDVLTRLEEFAPCLRLLYRDDFTRLYEIAGFPP* |
Ga0111539_134463552 | 3300009094 | Populus Rhizosphere | LEPERVRYAIFHLNGYNEENRNDVLKRLKELAPYFRPLYEDETTRLYEIVGFPP* |
Ga0099792_107454772 | 3300009143 | Vadose Zone Soil | HMYGYNAENRRDVLARLKEFEPYLRPLYVQDPLRLYEIMGFPP* |
Ga0105243_115478492 | 3300009148 | Miscanthus Rhizosphere | YAMFHMYGYNTENRNDVLARLKQFESYLRPLYVDESTRLYEIVGFPP* |
Ga0111538_107718581 | 3300009156 | Populus Rhizosphere | RAALKVLEPERVRYAIFHLNGYNEENRNDVLKRLKELAPYFRPLYEDETTRLYEIVGFPP |
Ga0105248_102499741 | 3300009177 | Switchgrass Rhizosphere | LLEPGRVRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP* |
Ga0105237_127623492 | 3300009545 | Corn Rhizosphere | VRYALLHMNGYNTENRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP* |
Ga0126308_107580243 | 3300010040 | Serpentine Soil | VFHMNGYNAANRNDVLTRLKEFQPYLRLVYSDESARLYEITGFPR* |
Ga0126382_121577172 | 3300010047 | Tropical Forest Soil | LGSRHVRYAVFHKYWYNDPNWHDVTTRLKEFEAYLRPLYADEGTRLYEIVGTPP* |
Ga0126377_110663843 | 3300010362 | Tropical Forest Soil | RYAVFHMYWYNDENRRDVLERLKEFEPYLRLLYGDEGTRLYEIVGAPP* |
Ga0126377_128835612 | 3300010362 | Tropical Forest Soil | KVRYAVFHMYGYNEANRKEVFGRLEELSAYFRLIYSGEETRLYEIVKYPQD* |
Ga0137389_105133822 | 3300012096 | Vadose Zone Soil | LEQSRVRYALFHRYWYNHENWRDVTARLKEFDAYLKPLYKDESTRLYEIVGFPP* |
Ga0137380_100277891 | 3300012206 | Vadose Zone Soil | RYALFHMYGYNAANRRDVLCRLKEFEAYLRPIYDDGDARLYEIVGFPP* |
Ga0137387_110103182 | 3300012349 | Vadose Zone Soil | LQPAGVRYAIFHMYGYNAQNRSEVLGRLERFTEYLRPIYVTEDTRLYEIVGFPP* |
Ga0137369_110203291 | 3300012355 | Vadose Zone Soil | ENRRDIVARLKEFEDYLRPLYIDDQTRLYEIVGFPP* |
Ga0150984_1118875991 | 3300012469 | Avena Fatua Rhizosphere | NDENWNDVVARLKEFAPYLRPLYDAENTRLYEIVGFPP* |
Ga0137396_101940711 | 3300012918 | Vadose Zone Soil | NTENRNDVLGRLKEFALYLRQLYVDDETQLYEIIGYPP* |
Ga0137413_108874711 | 3300012924 | Vadose Zone Soil | AVRYAVLHMNGYNAENRHDVLTRLKEFEPYLRPLYMDETTRLYEIVRYPP* |
Ga0164300_102077031 | 3300012951 | Soil | YGYNTENRNDVLARLKQFEQYLRPLYMVLGIRLYEIV* |
Ga0164308_105481692 | 3300012985 | Soil | GWTVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP* |
Ga0157378_124086591 | 3300013297 | Miscanthus Rhizosphere | MYGYNAQNRADVLGRLKEFEPYLRPLYVDDTLRLYEIVGFPP* |
Ga0157375_108431042 | 3300013308 | Miscanthus Rhizosphere | RNDVLTRLKEFEPYLRPLYQDESTRLYEIVGFPP* |
Ga0157375_129492942 | 3300013308 | Miscanthus Rhizosphere | IFHWYSYNQENRRDVKARLKEFENYLRPLYADQETQLFEIVGFPR* |
Ga0137418_111075962 | 3300015241 | Vadose Zone Soil | WFNDENWQDVLTRSKTAEPYVRPLYDGEGTRLYEVVGFPP* |
Ga0137412_106639602 | 3300015242 | Vadose Zone Soil | MNGYNAENRHDVLTRLKEFEPYLRPLYMDETTRLYEIVRYPP* |
Ga0137412_109953101 | 3300015242 | Vadose Zone Soil | TNVRYAIFHRYWFNDENWQDVLTRLKAAEPYVRLLYEDEGTRLYEIDGFPP* |
Ga0137403_109744212 | 3300015264 | Vadose Zone Soil | EPNKVRYAVFHRYWYNDENWSDVVQRLQEFGPYLHLVYDGENTRLYEIVGFPP* |
Ga0134073_101995392 | 3300015356 | Grasslands Soil | HRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR* |
Ga0132256_1032898591 | 3300015372 | Arabidopsis Rhizosphere | RVRYALFHRYWYNDENWQDVVTRLNEFEPYLRPLYDGENTRLYEIVGFPP* |
Ga0132257_1028061172 | 3300015373 | Arabidopsis Rhizosphere | RNQVLTRLKEFENYMRPLYADDYTRLYEIVGFPK* |
Ga0182034_116003842 | 3300016371 | Soil | SRPAFKILEPNAVRYAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFP |
Ga0184628_105650462 | 3300018083 | Groundwater Sediment | AENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP |
Ga0190274_132817692 | 3300018476 | Soil | RDHVETLKFFPSRDGFKVLEPLRVRYAVWHMYGYNESNRNDVVNRLKEFENYLRPLYVDDATRLYEIIGFPP |
Ga0066669_109375732 | 3300018482 | Grasslands Soil | KILEPDRVRYAVFHMYGFNAANRRDVLARLDEYTAYLRPLYSDEITRLYEIVAFPP |
Ga0193692_10336231 | 3300020000 | Soil | FPSHDAFKILEPNGVRYALLHMNGYNTENRNDVLTRLKEFEQYLRPLYMDETTRLYEIVGFPP |
Ga0193753_102209332 | 3300020034 | Soil | HMNGYNTENRNDVLTRLKEFERYLRPLYMDETTRLYEIVGFPPCPATGARSAGL |
Ga0213874_102591772 | 3300021377 | Plant Roots | AFKILEPDRVRYAVLHMYGYNEPNRRDVRSRLGEFAAYLRPLYKDSRSELYEIVGYPK |
Ga0247673_10582492 | 3300024224 | Soil | RDSFKLLEPNRVRYAVFHMYGYNTQNRNEVLARLTQFEPYLRPLYMDEGTRLYEIVGFPP |
Ga0207697_104430901 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR |
Ga0207680_105103121 | 3300025903 | Switchgrass Rhizosphere | GVRYALLHMNGYNTENRNDVLTRLKEFEPYLRPLYMDETTRLYEIVGFPP |
Ga0207643_103253682 | 3300025908 | Miscanthus Rhizosphere | RDAFKILEPNRVRYAVFHMNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR |
Ga0207671_107169432 | 3300025914 | Corn Rhizosphere | RVRYAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYQDESTRLYEIVGFPP |
Ga0207662_107339162 | 3300025918 | Switchgrass Rhizosphere | AVFHMNGDNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR |
Ga0207686_102006354 | 3300025934 | Miscanthus Rhizosphere | RVRYAVFHMYGYNTQNRNEVLARLTQFEPYLRPLYMDEGTRLYEIVGFPP |
Ga0207709_105371382 | 3300025935 | Miscanthus Rhizosphere | MYGYNDENRAEVLGRLKQFKRYLRLLYMDQTLRLYEIIDFPDE |
Ga0207711_116433441 | 3300025941 | Switchgrass Rhizosphere | AVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP |
Ga0207703_117382683 | 3300026035 | Switchgrass Rhizosphere | HMYGYNAENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP |
Ga0207641_100621684 | 3300026088 | Switchgrass Rhizosphere | VRYAMFHLNGYNASNRRDILTRLEQLAPYFKSIYLDDQTRLYEIVGFPP |
Ga0207648_102011434 | 3300026089 | Miscanthus Rhizosphere | HMYGYNAENRSDVLTRLKQFEPHLRPLYVDEATRLYEIVGFPP |
Ga0207648_105042642 | 3300026089 | Miscanthus Rhizosphere | ENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP |
Ga0209267_11492322 | 3300026331 | Soil | YAVFHRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR |
Ga0209808_11853502 | 3300026523 | Soil | HIRYAVFHMHWYNVENQNDVIGRLKQFAPYLRLIYADRSTRLYEIVGFPR |
Ga0179593_12321464 | 3300026555 | Vadose Zone Soil | MYGYNTENRNDVLTRLKEFAPYLRPLYMDETTRLYEIVLYPE |
Ga0209179_11532311 | 3300027512 | Vadose Zone Soil | ILEPNGVRYALLHMNGYNTENRNDVLTRLKEFERYLRPLYMDETTRLYEIVRYPP |
Ga0268264_105224881 | 3300028381 | Switchgrass Rhizosphere | RVRYAMFHMYGYNTENRNDVLTRLKQFESYLRPLYVDENTRLYEIVGFPP |
Ga0268264_117208851 | 3300028381 | Switchgrass Rhizosphere | IDGARYAVLHMYRYNASNRADVVGRLKEFEPYLRPLYVDDQTRLYEIIGFPP |
Ga0307280_103736661 | 3300028768 | Soil | AVFHMNGYNTENRHDVLARLEEFKAYLRPLYTDDTTRLYEIVGFPP |
Ga0307312_102602971 | 3300028828 | Soil | AFKILEPLRVRYAVFHTYGYNTRNRNEVLARLAEFEPYLRPLYIDDTLRLYEIVGFPP |
Ga0307277_101695202 | 3300028881 | Soil | RYAVFHMNGYNTENRNDVLGRLREFAPYLRQIYVDDDTQLYEIVGYPQ |
Ga0307277_104368582 | 3300028881 | Soil | GAFKILEPLRVRYAVFHTYGYNTRNRNEVLARLAEFEPYLRPLYIDDTLRLYEIVGFPP |
Ga0170824_1133145811 | 3300031231 | Forest Soil | NPENRHDVEERLKQFAAYLRPLYADANTQLYEIVGFPP |
Ga0307506_105183311 | 3300031366 | Soil | DAFKLLEPGRVRYAVFHMYGYNTENRNDVLTRLKQFEQYLRPLYMDDGTRLYEIVGFPP |
Ga0318541_106601222 | 3300031545 | Soil | LKVRYAVFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFPP |
Ga0307508_106691581 | 3300031616 | Ectomycorrhiza | FHMNGYNSENRNDVLTRLKEFERYLRPLYMDETTRLYEIVGFPP |
Ga0318561_100528561 | 3300031679 | Soil | AVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFPK |
Ga0318500_103872822 | 3300031724 | Soil | TRPAMKLLEPLKVRYAVFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFP |
Ga0307468_1010637721 | 3300031740 | Hardwood Forest Soil | SRDALKLLEPIGVRYAVLHMYGYNAENRNDVLKRLKEFEAYLRPLYTTDATRLYEITGSP |
Ga0318566_102361232 | 3300031779 | Soil | LLEPLKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP |
Ga0318564_103120181 | 3300031831 | Soil | VFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFPP |
Ga0318536_105664572 | 3300031893 | Soil | LEPLKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP |
Ga0318513_102429091 | 3300032065 | Soil | LKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP |
Ga0315286_119261532 | 3300032342 | Sediment | LLAPNHVRYAVFHMYWYNDQNRADVIARLQEFAPYLRPLYIDGDTRLYEIVATPP |
Ga0335084_106995062 | 3300033004 | Soil | RYAMFHMYGYNDINRQQVLDRLKEFEPYLRPLYADEQTRLYEIVSYPR |
⦗Top⦘ |