NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095663

Metagenome / Metatranscriptome Family F095663

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095663
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 48 residues
Representative Sequence RYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP
Number of Associated Samples 92
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 96.19 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.238 % of family members)
Environment Ontology (ENVO) Unclassified
(47.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(57.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 22.37%    Coil/Unstructured: 52.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.144.1.0: automated matchesd3fe3a_3fe30.73044
d.144.1.0: automated matchesd3hmoa_3hmo0.72176
d.58.18.14: TM1266-liked2nzca12nzc0.70958
d.144.1.0: automated matchesd4b9da14b9d0.68957
d.139.1.1: PurM C-terminal domain-liked1t3ta71t3t0.67171


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03706LPG_synthase_TM 57.14
PF07519Tannase 1.90
PF12072RNase_Y_N 0.95
PF00206Lyase_1 0.95
PF0563523S_rRNA_IVP 0.95
PF00165HTH_AraC 0.95
PF13396PLDc_N 0.95
PF13472Lipase_GDSL_2 0.95
PF13649Methyltransf_25 0.95
PF13579Glyco_trans_4_4 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 57.14


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.14 %
UnclassifiedrootN/A2.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS401AMZGZAll Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005178|Ga0066688_10344632All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005332|Ga0066388_102876853All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300005332|Ga0066388_104019106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300005334|Ga0068869_100271997All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300005335|Ga0070666_11231414All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300005355|Ga0070671_101694496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300005367|Ga0070667_100814307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300005467|Ga0070706_101524783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300005467|Ga0070706_101877753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300005563|Ga0068855_100482092All Organisms → cellular organisms → Bacteria → Acidobacteria1350Open in IMG/M
3300005586|Ga0066691_10356088All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300005615|Ga0070702_101568259All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300005617|Ga0068859_101747767All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300005617|Ga0068859_102049939All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300005617|Ga0068859_102656653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300005618|Ga0068864_100980313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium838Open in IMG/M
3300005618|Ga0068864_102627305All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300005719|Ga0068861_101261951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300005764|Ga0066903_104564280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300005834|Ga0068851_11005366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300006047|Ga0075024_100520942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300006237|Ga0097621_100353970All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300006914|Ga0075436_100570764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium832Open in IMG/M
3300006953|Ga0074063_13135374All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300006954|Ga0079219_10548357Not Available828Open in IMG/M
3300007076|Ga0075435_100489696All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300007265|Ga0099794_10653975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300009012|Ga0066710_100071208All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis4463Open in IMG/M
3300009012|Ga0066710_101576922Not Available1008Open in IMG/M
3300009012|Ga0066710_102359088All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300009089|Ga0099828_10812965All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300009090|Ga0099827_10549242All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300009094|Ga0111539_13446355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300009143|Ga0099792_10745477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300009148|Ga0105243_11547849All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300009156|Ga0111538_10771858All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300009177|Ga0105248_10249974All Organisms → cellular organisms → Bacteria → Acidobacteria1996Open in IMG/M
3300009545|Ga0105237_12762349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010040|Ga0126308_10758024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300010047|Ga0126382_12157717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300010362|Ga0126377_11066384All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300010362|Ga0126377_12883561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300012096|Ga0137389_10513382All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300012206|Ga0137380_10027789All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis5210Open in IMG/M
3300012349|Ga0137387_11010318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300012355|Ga0137369_11020329Not Available547Open in IMG/M
3300012469|Ga0150984_111887599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300012918|Ga0137396_10194071All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300012924|Ga0137413_10887471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300012951|Ga0164300_10207703All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300012985|Ga0164308_10548169All Organisms → cellular organisms → Bacteria → Acidobacteria975Open in IMG/M
3300013297|Ga0157378_12408659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300013308|Ga0157375_10843104All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300013308|Ga0157375_12949294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300015241|Ga0137418_11107596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300015242|Ga0137412_10663960All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300015242|Ga0137412_10995310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300015264|Ga0137403_10974421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300015356|Ga0134073_10199539All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300015372|Ga0132256_103289859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300015373|Ga0132257_102806117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300016371|Ga0182034_11600384All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300018083|Ga0184628_10565046All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300018476|Ga0190274_13281769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300018482|Ga0066669_10937573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300020000|Ga0193692_1033623All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300020034|Ga0193753_10220933All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300021377|Ga0213874_10259177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300024224|Ga0247673_1058249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300025315|Ga0207697_10443090All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300025903|Ga0207680_10510312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300025908|Ga0207643_10325368All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300025914|Ga0207671_10716943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300025918|Ga0207662_10733916All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300025934|Ga0207686_10200635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1428Open in IMG/M
3300025935|Ga0207709_10537138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300025941|Ga0207711_11643344All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300026035|Ga0207703_11738268All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300026088|Ga0207641_10062168All Organisms → cellular organisms → Bacteria → Acidobacteria3186Open in IMG/M
3300026089|Ga0207648_10201143All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300026089|Ga0207648_10504264All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300026331|Ga0209267_1149232All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300026523|Ga0209808_1185350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300026555|Ga0179593_1232146All Organisms → cellular organisms → Bacteria2340Open in IMG/M
3300027512|Ga0209179_1153231All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300028381|Ga0268264_10522488All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300028381|Ga0268264_11720885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300028768|Ga0307280_10373666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300028828|Ga0307312_10260297All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300028881|Ga0307277_10169520All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300028881|Ga0307277_10436858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300031231|Ga0170824_113314581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300031366|Ga0307506_10518331All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300031545|Ga0318541_10660122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300031616|Ga0307508_10669158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300031679|Ga0318561_10052856All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis2038Open in IMG/M
3300031724|Ga0318500_10387282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300031740|Ga0307468_101063772All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300031779|Ga0318566_10236123All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031831|Ga0318564_10312018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300031893|Ga0318536_10566457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300032065|Ga0318513_10242909All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300032342|Ga0315286_11926153All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300033004|Ga0335084_10699506All Organisms → cellular organisms → Bacteria1033Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.90%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.95%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_081921602189573004Grass SoilVETLKFFPRRDAFKILEPNKVRYAVIHLYGYNEDDRRAELARLKEFSQYLKPLYDDSFTQLYEIVGFPP
Ga0066688_1034463213300005178SoilYAVFHRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR*
Ga0066388_10287685313300005332Tropical Forest SoilVRYAVFHMYGYNASNRSDVEVRLKQLEKYFRLLYEGEGTRLYEIVGYPP*
Ga0066388_10401910623300005332Tropical Forest SoilHMYGYNESNRQDVITRLDQLQSHFRLLYEGEGTRLYEILSYPPEK*
Ga0068869_10027199723300005334Miscanthus RhizosphereHMNGYNTENRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP*
Ga0070666_1123141423300005335Switchgrass RhizosphereVRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP*
Ga0070671_10169449623300005355Switchgrass RhizosphereFHMNGYNTENRTDVMTRLKEFEPYLRPLYTDEWTRLYEIVGFPP*
Ga0070667_10081430713300005367Switchgrass RhizosphereYGYNASNRADVIGRLKEFEPYLRPLYVDDQTRLYEIIGFPP*
Ga0070706_10152478323300005467Corn, Switchgrass And Miscanthus RhizosphereYWFNDENWQDVLTRLKTAEPYMRLLYDGEGTQLYEVVGFPP*
Ga0070706_10187775323300005467Corn, Switchgrass And Miscanthus RhizosphereHMDWYNIENRKDVVGRLKEFAPYLRLIYADHATRLYEIVGFPR*
Ga0068855_10048209233300005563Corn RhizosphereTENRTDVLTRLKEFEPYLRPLYMDEWTRLYEIVGFPP*
Ga0066691_1035608813300005586SoilLLEPLHIRYAVFHMHWYNVENQNDVIGRLKQFAPYLRLIYADRSTRLYEIVGFPR*
Ga0070702_10156825913300005615Corn, Switchgrass And Miscanthus RhizosphereRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP*
Ga0068859_10174776713300005617Switchgrass RhizosphereGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP*
Ga0068859_10204993913300005617Switchgrass RhizosphereRYAVFHMNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR*
Ga0068859_10265665323300005617Switchgrass RhizosphereAVLHMYGYNASNRADVIGRLKEFEPYLRPLYVDDQTRLYEIIGFPP*
Ga0068864_10098031323300005618Switchgrass RhizosphereGYNTENRNDVLTRLEEFKAYLRPLYADETTRLYEIVGFPR*
Ga0068864_10262730523300005618Switchgrass RhizosphereVRYAMFHMYGYNAENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP*
Ga0068861_10126195123300005719Switchgrass RhizosphereMYGYNAANRADVVGRLKEFEAYLRPLYVDDQTRLYEIIGFPP*
Ga0066903_10456428023300005764Tropical Forest SoilYAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFPK*
Ga0068851_1100536613300005834Corn RhizosphereGYNTENRNDVLARLKEFEPYLRPLYMDETTRLYEIVGFPP*
Ga0075024_10052094223300006047WatershedsAVFHMNGYNTENRNDVLTRLKEFERYLRPLYADDTTRLYEIVGFPP*
Ga0097621_10035397023300006237Miscanthus RhizosphereNRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP*
Ga0075436_10057076413300006914Populus RhizosphereWYNDPNWGDVVARLKEFEPYVRQLYDGENTRLYEIVGSPP*
Ga0074063_1313537423300006953SoilLEPGRVRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDDGTRLYEIVGFPP*
Ga0079219_1054835723300006954Agricultural SoilMKLIEPWKVRYAIFHMGGYNEPNRRDTELRLKQLESYFRPLYVSDTTRLYEIVGFPP*
Ga0075435_10048969613300007076Populus RhizosphereYWYNDENWRDVTTRLKEFHPYLRRLYEDEGTRLYEIVGAPK*
Ga0099794_1065397523300007265Vadose Zone SoilWYNHENWRDVTARLKEFDAYLKPLYKDEGTRLYEIVGFPP*
Ga0066710_10007120853300009012Grasslands SoilYNTENRNDVLGRLKEFAPYLRQLYVDDETQLYEIIGYPP
Ga0066710_10157692223300009012Grasslands SoilYWYNSENQRDVLTRLKELEPYFRPLYIDADTRLYEIVGYPH
Ga0066710_10235908813300009012Grasslands SoilVRYAIFHMYGYNAQNRSEVLGRLKRFTEYLRPIYMTEDTRLYEIVGFPP
Ga0099828_1081296513300009089Vadose Zone SoilENWQDVLTRLKNAEPYMRLLYDGEGTRLYEIVGFPP*
Ga0099827_1054924213300009090Vadose Zone SoilALKILEPNGVRYAVFHMYGFNTENRHDVLTRLEEFAPCLRLLYRDDFTRLYEIAGFPP*
Ga0111539_1344635523300009094Populus RhizosphereLEPERVRYAIFHLNGYNEENRNDVLKRLKELAPYFRPLYEDETTRLYEIVGFPP*
Ga0099792_1074547723300009143Vadose Zone SoilHMYGYNAENRRDVLARLKEFEPYLRPLYVQDPLRLYEIMGFPP*
Ga0105243_1154784923300009148Miscanthus RhizosphereYAMFHMYGYNTENRNDVLARLKQFESYLRPLYVDESTRLYEIVGFPP*
Ga0111538_1077185813300009156Populus RhizosphereRAALKVLEPERVRYAIFHLNGYNEENRNDVLKRLKELAPYFRPLYEDETTRLYEIVGFPP
Ga0105248_1024997413300009177Switchgrass RhizosphereLLEPGRVRYAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP*
Ga0105237_1276234923300009545Corn RhizosphereVRYALLHMNGYNTENRNDVLARLKEFERYLRPLYMDETTRLYEIVGFPP*
Ga0126308_1075802433300010040Serpentine SoilVFHMNGYNAANRNDVLTRLKEFQPYLRLVYSDESARLYEITGFPR*
Ga0126382_1215771723300010047Tropical Forest SoilLGSRHVRYAVFHKYWYNDPNWHDVTTRLKEFEAYLRPLYADEGTRLYEIVGTPP*
Ga0126377_1106638433300010362Tropical Forest SoilRYAVFHMYWYNDENRRDVLERLKEFEPYLRLLYGDEGTRLYEIVGAPP*
Ga0126377_1288356123300010362Tropical Forest SoilKVRYAVFHMYGYNEANRKEVFGRLEELSAYFRLIYSGEETRLYEIVKYPQD*
Ga0137389_1051338223300012096Vadose Zone SoilLEQSRVRYALFHRYWYNHENWRDVTARLKEFDAYLKPLYKDESTRLYEIVGFPP*
Ga0137380_1002778913300012206Vadose Zone SoilRYALFHMYGYNAANRRDVLCRLKEFEAYLRPIYDDGDARLYEIVGFPP*
Ga0137387_1101031823300012349Vadose Zone SoilLQPAGVRYAIFHMYGYNAQNRSEVLGRLERFTEYLRPIYVTEDTRLYEIVGFPP*
Ga0137369_1102032913300012355Vadose Zone SoilENRRDIVARLKEFEDYLRPLYIDDQTRLYEIVGFPP*
Ga0150984_11188759913300012469Avena Fatua RhizosphereNDENWNDVVARLKEFAPYLRPLYDAENTRLYEIVGFPP*
Ga0137396_1019407113300012918Vadose Zone SoilNTENRNDVLGRLKEFALYLRQLYVDDETQLYEIIGYPP*
Ga0137413_1088747113300012924Vadose Zone SoilAVRYAVLHMNGYNAENRHDVLTRLKEFEPYLRPLYMDETTRLYEIVRYPP*
Ga0164300_1020770313300012951SoilYGYNTENRNDVLARLKQFEQYLRPLYMVLGIRLYEIV*
Ga0164308_1054816923300012985SoilGWTVLARLKQFEQYLRPLYMDEGTRLYEIVGFPP*
Ga0157378_1240865913300013297Miscanthus RhizosphereMYGYNAQNRADVLGRLKEFEPYLRPLYVDDTLRLYEIVGFPP*
Ga0157375_1084310423300013308Miscanthus RhizosphereRNDVLTRLKEFEPYLRPLYQDESTRLYEIVGFPP*
Ga0157375_1294929423300013308Miscanthus RhizosphereIFHWYSYNQENRRDVKARLKEFENYLRPLYADQETQLFEIVGFPR*
Ga0137418_1110759623300015241Vadose Zone SoilWFNDENWQDVLTRSKTAEPYVRPLYDGEGTRLYEVVGFPP*
Ga0137412_1066396023300015242Vadose Zone SoilMNGYNAENRHDVLTRLKEFEPYLRPLYMDETTRLYEIVRYPP*
Ga0137412_1099531013300015242Vadose Zone SoilTNVRYAIFHRYWFNDENWQDVLTRLKAAEPYVRLLYEDEGTRLYEIDGFPP*
Ga0137403_1097442123300015264Vadose Zone SoilEPNKVRYAVFHRYWYNDENWSDVVQRLQEFGPYLHLVYDGENTRLYEIVGFPP*
Ga0134073_1019953923300015356Grasslands SoilHRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR*
Ga0132256_10328985913300015372Arabidopsis RhizosphereRVRYALFHRYWYNDENWQDVVTRLNEFEPYLRPLYDGENTRLYEIVGFPP*
Ga0132257_10280611723300015373Arabidopsis RhizosphereRNQVLTRLKEFENYMRPLYADDYTRLYEIVGFPK*
Ga0182034_1160038423300016371SoilSRPAFKILEPNAVRYAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFP
Ga0184628_1056504623300018083Groundwater SedimentAENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP
Ga0190274_1328176923300018476SoilRDHVETLKFFPSRDGFKVLEPLRVRYAVWHMYGYNESNRNDVVNRLKEFENYLRPLYVDDATRLYEIIGFPP
Ga0066669_1093757323300018482Grasslands SoilKILEPDRVRYAVFHMYGFNAANRRDVLARLDEYTAYLRPLYSDEITRLYEIVAFPP
Ga0193692_103362313300020000SoilFPSHDAFKILEPNGVRYALLHMNGYNTENRNDVLTRLKEFEQYLRPLYMDETTRLYEIVGFPP
Ga0193753_1022093323300020034SoilHMNGYNTENRNDVLTRLKEFERYLRPLYMDETTRLYEIVGFPPCPATGARSAGL
Ga0213874_1025917723300021377Plant RootsAFKILEPDRVRYAVLHMYGYNEPNRRDVRSRLGEFAAYLRPLYKDSRSELYEIVGYPK
Ga0247673_105824923300024224SoilRDSFKLLEPNRVRYAVFHMYGYNTQNRNEVLARLTQFEPYLRPLYMDEGTRLYEIVGFPP
Ga0207697_1044309013300025315Corn, Switchgrass And Miscanthus RhizosphereMNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR
Ga0207680_1051031213300025903Switchgrass RhizosphereGVRYALLHMNGYNTENRNDVLTRLKEFEPYLRPLYMDETTRLYEIVGFPP
Ga0207643_1032536823300025908Miscanthus RhizosphereRDAFKILEPNRVRYAVFHMNGYNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR
Ga0207671_1071694323300025914Corn RhizosphereRVRYAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYQDESTRLYEIVGFPP
Ga0207662_1073391623300025918Switchgrass RhizosphereAVFHMNGDNTINRDEVLARLKEFEPYLRPLYADDTTRLYEIVGFPR
Ga0207686_1020063543300025934Miscanthus RhizosphereRVRYAVFHMYGYNTQNRNEVLARLTQFEPYLRPLYMDEGTRLYEIVGFPP
Ga0207709_1053713823300025935Miscanthus RhizosphereMYGYNDENRAEVLGRLKQFKRYLRLLYMDQTLRLYEIIDFPDE
Ga0207711_1164334413300025941Switchgrass RhizosphereAVFHMYGYNTENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP
Ga0207703_1173826833300026035Switchgrass RhizosphereHMYGYNAENRNDVLTRLKQFEAYLRPLYVDEGTRLYEIVGFPP
Ga0207641_1006216843300026088Switchgrass RhizosphereVRYAMFHLNGYNASNRRDILTRLEQLAPYFKSIYLDDQTRLYEIVGFPP
Ga0207648_1020114343300026089Miscanthus RhizosphereHMYGYNAENRSDVLTRLKQFEPHLRPLYVDEATRLYEIVGFPP
Ga0207648_1050426423300026089Miscanthus RhizosphereENRNDVLARLKQFEQYLRPLYMDEGTGTRLYEIVGFPP
Ga0209267_114923223300026331SoilYAVFHRYWYNDENWRDVKTRLREFHPYLRRLYVDEETRLYEIVGAPR
Ga0209808_118535023300026523SoilHIRYAVFHMHWYNVENQNDVIGRLKQFAPYLRLIYADRSTRLYEIVGFPR
Ga0179593_123214643300026555Vadose Zone SoilMYGYNTENRNDVLTRLKEFAPYLRPLYMDETTRLYEIVLYPE
Ga0209179_115323113300027512Vadose Zone SoilILEPNGVRYALLHMNGYNTENRNDVLTRLKEFERYLRPLYMDETTRLYEIVRYPP
Ga0268264_1052248813300028381Switchgrass RhizosphereRVRYAMFHMYGYNTENRNDVLTRLKQFESYLRPLYVDENTRLYEIVGFPP
Ga0268264_1172088513300028381Switchgrass RhizosphereIDGARYAVLHMYRYNASNRADVVGRLKEFEPYLRPLYVDDQTRLYEIIGFPP
Ga0307280_1037366613300028768SoilAVFHMNGYNTENRHDVLARLEEFKAYLRPLYTDDTTRLYEIVGFPP
Ga0307312_1026029713300028828SoilAFKILEPLRVRYAVFHTYGYNTRNRNEVLARLAEFEPYLRPLYIDDTLRLYEIVGFPP
Ga0307277_1016952023300028881SoilRYAVFHMNGYNTENRNDVLGRLREFAPYLRQIYVDDDTQLYEIVGYPQ
Ga0307277_1043685823300028881SoilGAFKILEPLRVRYAVFHTYGYNTRNRNEVLARLAEFEPYLRPLYIDDTLRLYEIVGFPP
Ga0170824_11331458113300031231Forest SoilNPENRHDVEERLKQFAAYLRPLYADANTQLYEIVGFPP
Ga0307506_1051833113300031366SoilDAFKLLEPGRVRYAVFHMYGYNTENRNDVLTRLKQFEQYLRPLYMDDGTRLYEIVGFPP
Ga0318541_1066012223300031545SoilLKVRYAVFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFPP
Ga0307508_1066915813300031616EctomycorrhizaFHMNGYNSENRNDVLTRLKEFERYLRPLYMDETTRLYEIVGFPP
Ga0318561_1005285613300031679SoilAVFHMYGYNTENRNDVLTRLKEFEPYLRPLYMDDTTRLYEIVGFPK
Ga0318500_1038728223300031724SoilTRPAMKLLEPLKVRYAVFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFP
Ga0307468_10106377213300031740Hardwood Forest SoilSRDALKLLEPIGVRYAVLHMYGYNAENRNDVLKRLKEFEAYLRPLYTTDATRLYEITGSP
Ga0318566_1023612323300031779SoilLLEPLKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP
Ga0318564_1031201813300031831SoilVFHMYGYNAENRHDIEVRLEELRQYFRPLYADEGTRLYEIVGFPP
Ga0318536_1056645723300031893SoilLEPLKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP
Ga0318513_1024290913300032065SoilLKVRYAVFHMYGYNAENRRDVEVRLEELGQYFRPLYADEGTRLYEIVGFPP
Ga0315286_1192615323300032342SedimentLLAPNHVRYAVFHMYWYNDQNRADVIARLQEFAPYLRPLYIDGDTRLYEIVATPP
Ga0335084_1069950623300033004SoilRYAMFHMYGYNDINRQQVLDRLKEFEPYLRPLYADEQTRLYEIVSYPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.