| Basic Information | |
|---|---|
| Family ID | F095661 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.95 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 15.24 |
| PF08241 | Methyltransf_11 | 4.76 |
| PF12543 | DUF3738 | 2.86 |
| PF00593 | TonB_dep_Rec | 2.86 |
| PF01522 | Polysacc_deac_1 | 1.90 |
| PF01053 | Cys_Met_Meta_PP | 1.90 |
| PF09594 | GT87 | 0.95 |
| PF00069 | Pkinase | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF10282 | Lactonase | 0.95 |
| PF13380 | CoA_binding_2 | 0.95 |
| PF13533 | Biotin_lipoyl_2 | 0.95 |
| PF07676 | PD40 | 0.95 |
| PF01594 | AI-2E_transport | 0.95 |
| PF05974 | DUF892 | 0.95 |
| PF14080 | DUF4261 | 0.95 |
| PF00005 | ABC_tran | 0.95 |
| PF00890 | FAD_binding_2 | 0.95 |
| PF00378 | ECH_1 | 0.95 |
| PF02954 | HTH_8 | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF02900 | LigB | 0.95 |
| PF11937 | DUF3455 | 0.95 |
| PF00571 | CBS | 0.95 |
| PF00196 | GerE | 0.95 |
| PF00390 | malic | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.90 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.90 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.90 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.90 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.90 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.90 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.90 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.90 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.90 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.95 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.95 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.48 % |
| Unclassified | root | N/A | 9.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_100477959 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300005093|Ga0062594_102009799 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005290|Ga0065712_10018594 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300005293|Ga0065715_10028784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1946 | Open in IMG/M |
| 3300005293|Ga0065715_10933797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005295|Ga0065707_10531844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300005328|Ga0070676_11611456 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005343|Ga0070687_100396806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300005344|Ga0070661_101198886 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005353|Ga0070669_101825418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300005356|Ga0070674_101924167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 538 | Open in IMG/M |
| 3300005364|Ga0070673_100481098 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300005365|Ga0070688_100743680 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005438|Ga0070701_10325398 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005440|Ga0070705_101422365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300005466|Ga0070685_10065974 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300005564|Ga0070664_102339595 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005577|Ga0068857_100316353 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300005616|Ga0068852_101371408 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005718|Ga0068866_10369640 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005718|Ga0068866_10964478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300005840|Ga0068870_11316575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. LH128 | 527 | Open in IMG/M |
| 3300006237|Ga0097621_100409298 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006846|Ga0075430_100235246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
| 3300006881|Ga0068865_100692862 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300007004|Ga0079218_11868969 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009030|Ga0114950_10990390 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009139|Ga0114949_10316635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1244 | Open in IMG/M |
| 3300009139|Ga0114949_11351575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300009139|Ga0114949_11451524 | Not Available | 548 | Open in IMG/M |
| 3300009156|Ga0111538_10325548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1945 | Open in IMG/M |
| 3300009156|Ga0111538_11088971 | Not Available | 1010 | Open in IMG/M |
| 3300009156|Ga0111538_11182738 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300009162|Ga0075423_10120206 | All Organisms → cellular organisms → Bacteria | 2755 | Open in IMG/M |
| 3300009162|Ga0075423_11712325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300009171|Ga0105101_10596218 | Not Available | 548 | Open in IMG/M |
| 3300009553|Ga0105249_12345172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010304|Ga0134088_10474453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300011112|Ga0114947_10781382 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012173|Ga0137327_1142446 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012212|Ga0150985_106092093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012232|Ga0137435_1104558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300012232|Ga0137435_1173038 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012285|Ga0137370_11016564 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012908|Ga0157286_10133492 | Not Available | 771 | Open in IMG/M |
| 3300012910|Ga0157308_10240479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300013306|Ga0163162_13419315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300013308|Ga0157375_11238551 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300014326|Ga0157380_10335282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1408 | Open in IMG/M |
| 3300014969|Ga0157376_10367193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
| 3300015200|Ga0173480_10137191 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300015374|Ga0132255_102076869 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300018077|Ga0184633_10082277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1657 | Open in IMG/M |
| 3300018078|Ga0184612_10373697 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018429|Ga0190272_12723215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
| 3300018469|Ga0190270_10170627 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300018469|Ga0190270_10827815 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300018476|Ga0190274_12040774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300018481|Ga0190271_10568995 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300018481|Ga0190271_12330513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 640 | Open in IMG/M |
| 3300019248|Ga0180117_1205023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1035 | Open in IMG/M |
| 3300019377|Ga0190264_10293290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300019377|Ga0190264_10407142 | Not Available | 885 | Open in IMG/M |
| 3300022756|Ga0222622_10222029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300024060|Ga0209987_10331846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300024431|Ga0209988_10312304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300024516|Ga0209980_10408333 | Not Available | 583 | Open in IMG/M |
| 3300025885|Ga0207653_10402735 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025908|Ga0207643_10752269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300025910|Ga0207684_10759312 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300025920|Ga0207649_10396568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300025920|Ga0207649_10874955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300025926|Ga0207659_11189878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300025930|Ga0207701_11693872 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025931|Ga0207644_11009825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300025933|Ga0207706_11283381 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025937|Ga0207669_10352196 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300025938|Ga0207704_10510136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300025942|Ga0207689_10997615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300025949|Ga0207667_11354297 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300026041|Ga0207639_10830803 | Not Available | 862 | Open in IMG/M |
| 3300026088|Ga0207641_10318827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1473 | Open in IMG/M |
| 3300026118|Ga0207675_100458628 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300026121|Ga0207683_10345099 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300027637|Ga0209818_1064685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300027876|Ga0209974_10472122 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027909|Ga0209382_10135783 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300028380|Ga0268265_12086993 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300028803|Ga0307281_10163116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300031538|Ga0310888_10978326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella immobilis | 531 | Open in IMG/M |
| 3300031824|Ga0307413_10268971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1275 | Open in IMG/M |
| 3300031847|Ga0310907_10399254 | Not Available | 716 | Open in IMG/M |
| 3300031908|Ga0310900_10851175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300031911|Ga0307412_12105910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032000|Ga0310903_10517738 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032005|Ga0307411_11817065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300032013|Ga0310906_10185283 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300032013|Ga0310906_10408854 | Not Available | 898 | Open in IMG/M |
| 3300032211|Ga0310896_10108115 | Not Available | 1257 | Open in IMG/M |
| 3300033550|Ga0247829_10981665 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300033550|Ga0247829_11618735 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300034148|Ga0364927_0237959 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300034149|Ga0364929_0024427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1761 | Open in IMG/M |
| 3300034354|Ga0364943_0411601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300034417|Ga0364941_042544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.57% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 7.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024060 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024431 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063356_1004779591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LVEKHGARPRYKQSPGHNHSSQLLSVGTPDASVSRELVDFIERTVRR* |
| Ga0062594_1020097993 | 3300005093 | Soil | PRYTQSPGHNHSSQLWSLGTSDTSVSRELVDFIERTVKR* |
| Ga0065712_100185941 | 3300005290 | Miscanthus Rhizosphere | HKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR* |
| Ga0065715_100287841 | 3300005293 | Miscanthus Rhizosphere | GARPRYKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR* |
| Ga0065715_109337972 | 3300005293 | Miscanthus Rhizosphere | AAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0065707_105318443 | 3300005295 | Switchgrass Rhizosphere | LFKELLEKQARPRYRQSLGHNHVSQVLSVGTVDTSMSREVLDFIDRTIRR* |
| Ga0070676_116114561 | 3300005328 | Miscanthus Rhizosphere | PRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK* |
| Ga0070687_1003968061 | 3300005343 | Switchgrass Rhizosphere | ARPRYRQSLGHNHSSQLLSFGTGDTSVSRELVDFIETVIKR* |
| Ga0070661_1011988861 | 3300005344 | Corn Rhizosphere | VMPRYRQSLGHNHVSQLLSIGTVDTSISREILDFIDRVIHPVK* |
| Ga0070669_1018254181 | 3300005353 | Switchgrass Rhizosphere | AVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0070674_1019241671 | 3300005356 | Miscanthus Rhizosphere | ARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH* |
| Ga0070673_1004810982 | 3300005364 | Switchgrass Rhizosphere | YRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK* |
| Ga0070688_1007436801 | 3300005365 | Switchgrass Rhizosphere | ELIDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR* |
| Ga0070701_103253981 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK* |
| Ga0070705_1014223652 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EKNARPRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTIRR* |
| Ga0070685_100659742 | 3300005466 | Switchgrass Rhizosphere | VMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK* |
| Ga0070664_1023395952 | 3300005564 | Corn Rhizosphere | YRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVVHPVK* |
| Ga0068857_1003163532 | 3300005577 | Corn Rhizosphere | PRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVVHPVK* |
| Ga0068852_1013714081 | 3300005616 | Corn Rhizosphere | KQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR* |
| Ga0068866_103696402 | 3300005718 | Miscanthus Rhizosphere | VEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0068866_109644781 | 3300005718 | Miscanthus Rhizosphere | SLGHNHVSQLLSVGTADTSISREILDFIDRVTTG* |
| Ga0068870_113165751 | 3300005840 | Miscanthus Rhizosphere | EHGVVPRYLQSLGHNHSSQLLSVGTADRSVSATIVDFIERTVHSR* |
| Ga0097621_1004092981 | 3300006237 | Miscanthus Rhizosphere | RQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK* |
| Ga0075430_1002352463 | 3300006846 | Populus Rhizosphere | SLGHNHVSQLLSVGTADTSVSREILDFVEQVTALSHTP* |
| Ga0068865_1006928621 | 3300006881 | Miscanthus Rhizosphere | FSELVEKHHVKPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK* |
| Ga0079218_118689691 | 3300007004 | Agricultural Soil | PRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTLAR* |
| Ga0114950_109903902 | 3300009030 | Deep Subsurface | FAALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR* |
| Ga0114949_103166352 | 3300009139 | Deep Subsurface | LEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR* |
| Ga0114949_113515751 | 3300009139 | Deep Subsurface | AALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR* |
| Ga0114949_114515241 | 3300009139 | Deep Subsurface | KQSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR* |
| Ga0111538_103255482 | 3300009156 | Populus Rhizosphere | FKELLEKNARPRYRQSLGHNHVSQLLSVGTADTSVTREVLDFIDRTLKTPPR* |
| Ga0111538_110889711 | 3300009156 | Populus Rhizosphere | RPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR* |
| Ga0111538_111827383 | 3300009156 | Populus Rhizosphere | FKELLEKNARPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVAGH* |
| Ga0075423_101202064 | 3300009162 | Populus Rhizosphere | PRYKQSPGHNHSSQLWSLGTSDTSVSRELVDFIERTVKR* |
| Ga0075423_117123252 | 3300009162 | Populus Rhizosphere | QAAVYKELIDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR* |
| Ga0105101_105962181 | 3300009171 | Freshwater Sediment | RYPGPFAELFRELVEKHDARPRFRQSLGHTHTSQLLSIGTVDTSVSREILDFIDRIVGR* |
| Ga0105249_123451721 | 3300009553 | Switchgrass Rhizosphere | SPGHNHSSQLLSVGTPDTSVSSELVDFIERTVTRAE* |
| Ga0134088_104744531 | 3300010304 | Grasslands Soil | TELVEKHQARPRYRQSLGHNHVSQLLSMGTVASSVSREILDFIDRIVGR* |
| Ga0114947_107813822 | 3300011112 | Deep Subsurface | LAFAALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSGELVDFIERTIGR* |
| Ga0137327_11424461 | 3300012173 | Soil | LQSLGHNHSSQLLSVGTADESVSSIIVDFIERTGSR* |
| Ga0150985_1060920931 | 3300012212 | Avena Fatua Rhizosphere | VQKHGMRPRFRQSLGHNHVSQLLSVGTADTSISREILDFIDRVTTR* |
| Ga0137435_11045581 | 3300012232 | Soil | ARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR* |
| Ga0137435_11730381 | 3300012232 | Soil | HKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0137370_110165641 | 3300012285 | Vadose Zone Soil | VMPRYRQSLGHNHVSQLLSVGTSDTSVSREILDFINRVIGG* |
| Ga0157286_101334922 | 3300012908 | Soil | RELVEKHGARPRYKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR* |
| Ga0157308_102404791 | 3300012910 | Soil | AAVYNELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVKR* |
| Ga0163162_134193152 | 3300013306 | Switchgrass Rhizosphere | ELVEKHRARPRYKQSPGHNHSSQLLSVGTADTSVSRELVDFIERTVTR* |
| Ga0157375_112385512 | 3300013308 | Miscanthus Rhizosphere | QAAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0157380_103352821 | 3300014326 | Switchgrass Rhizosphere | SLGHNHSSQLLSLGTADRSVSGIIVDFIERTGSR* |
| Ga0157376_103671931 | 3300014969 | Miscanthus Rhizosphere | LVLKHAVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK* |
| Ga0173480_101371911 | 3300015200 | Soil | EKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0132255_1020768692 | 3300015374 | Arabidopsis Rhizosphere | VEKHQARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR* |
| Ga0184633_100822774 | 3300018077 | Groundwater Sediment | RYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRIVRR |
| Ga0184612_103736972 | 3300018078 | Groundwater Sediment | LIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR |
| Ga0190272_127232152 | 3300018429 | Soil | FEELVIEHGVVPRYKQSLGHNHSSQLLSVGTADTSVSAEVVDFIERTSGR |
| Ga0190270_101706271 | 3300018469 | Soil | ARPRYRQSLGHNHVSQLLSMGTVDTSVSREILDFIDRTLGH |
| Ga0190270_108278151 | 3300018469 | Soil | HKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR |
| Ga0190274_120407741 | 3300018476 | Soil | GARPRYRQSIGHNHSSQLLSVGTPDTSVSRELVDFIERTVTR |
| Ga0190271_105689951 | 3300018481 | Soil | ERHGARPRYRQSLGHNHSSQLLSVGTSDTSVSRELVDFIERTVKR |
| Ga0190271_123305131 | 3300018481 | Soil | QSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Ga0180117_12050231 | 3300019248 | Groundwater Sediment | EAQLFKELLEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTIRR |
| Ga0190264_102932901 | 3300019377 | Soil | LYKELVEKHGARPRYPQSLGHNHVSQLLSMGTVDASVSREILDFIDRTVGR |
| Ga0190264_104071422 | 3300019377 | Soil | YRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTIKH |
| Ga0222622_102220293 | 3300022756 | Groundwater Sediment | QSLGHNHSSQLLSVGTPDTSVSRELVDFIERVVKH |
| Ga0209987_103318461 | 3300024060 | Deep Subsurface | ELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR |
| Ga0209988_103123041 | 3300024431 | Deep Subsurface | QSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR |
| Ga0209980_104083332 | 3300024516 | Deep Subsurface | QSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR |
| Ga0207653_104027351 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LVQKHGMRPRFRQSLGHNHVSQLLSVGTADTSISREIVDFIDRVPAR |
| Ga0207643_107522692 | 3300025908 | Miscanthus Rhizosphere | VLKHAVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK |
| Ga0207684_107593122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK |
| Ga0207649_103965681 | 3300025920 | Corn Rhizosphere | LKHAVMPRYRQSLGHNHVSQLLSIGTVDTSISREILDFIDRVIHPVK |
| Ga0207649_108749552 | 3300025920 | Corn Rhizosphere | VLKHGVKPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK |
| Ga0207659_111898782 | 3300025926 | Miscanthus Rhizosphere | GARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH |
| Ga0207701_116938722 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Ga0207644_110098251 | 3300025931 | Switchgrass Rhizosphere | RQSLGHNHVSQLLSVGTADTSISREILDFIDRVTAR |
| Ga0207706_112833812 | 3300025933 | Corn Rhizosphere | AVYNELVEKHKARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVRR |
| Ga0207669_103521961 | 3300025937 | Miscanthus Rhizosphere | AVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR |
| Ga0207704_105101362 | 3300025938 | Miscanthus Rhizosphere | KHGVRPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK |
| Ga0207689_109976151 | 3300025942 | Miscanthus Rhizosphere | LVDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH |
| Ga0207667_113542973 | 3300025949 | Corn Rhizosphere | RQSLGHNHVSQLLSVGTADTSISREILDFIDRMRPR |
| Ga0207639_108308031 | 3300026041 | Corn Rhizosphere | KQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR |
| Ga0207641_103188272 | 3300026088 | Switchgrass Rhizosphere | KHGVMPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK |
| Ga0207675_1004586282 | 3300026118 | Switchgrass Rhizosphere | PQAAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR |
| Ga0207683_103450992 | 3300026121 | Miscanthus Rhizosphere | KQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVKR |
| Ga0209818_10646852 | 3300027637 | Agricultural Soil | PRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Ga0209974_104721221 | 3300027876 | Arabidopsis Thaliana Rhizosphere | TPRYLQSLGHNHSSQLLSLGTADRSVSGIIVDFIERTGSR |
| Ga0209382_101357834 | 3300027909 | Populus Rhizosphere | RPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Ga0268265_120869931 | 3300028380 | Switchgrass Rhizosphere | AVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR |
| Ga0307281_101631161 | 3300028803 | Soil | LFTELIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTTRR |
| Ga0310888_109783261 | 3300031538 | Soil | LVVEHGVVPRYLQSLGHNHSSQLLSVGTADRSVSGTIVDFIERTVHSR |
| Ga0307413_102689712 | 3300031824 | Rhizosphere | PRYFQSLGHNHSSQLLSVGTQDQSVSGIIIDFIERTGGR |
| Ga0310907_103992541 | 3300031847 | Soil | YRELIDKHGARPRYRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTSTH |
| Ga0310900_108511752 | 3300031908 | Soil | RELIDKHGARPRYRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTAKN |
| Ga0307412_121059102 | 3300031911 | Rhizosphere | GARPRYRQSLGHNHSSQLFSVGTADTSVSRELVDFIERTVKR |
| Ga0310903_105177381 | 3300032000 | Soil | EKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR |
| Ga0307411_118170652 | 3300032005 | Rhizosphere | EKHGARPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERNVRR |
| Ga0310906_101852831 | 3300032013 | Soil | PRYKQSPGHNHSSQLLSVGTADTSVSRELVDFIERTVTR |
| Ga0310906_104088541 | 3300032013 | Soil | YKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR |
| Ga0310896_101081152 | 3300032211 | Soil | LVEKHGARPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR |
| Ga0247829_109816651 | 3300033550 | Soil | EKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTITR |
| Ga0247829_116187351 | 3300033550 | Soil | AALFAELVTEHGATPRYLQSLGHNHSSQLLSVGTSDQSVSGVIVDFIERTGGR |
| Ga0364927_0237959_380_535 | 3300034148 | Sediment | VYNELVEKHNGRPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTITR |
| Ga0364929_0024427_3_143 | 3300034149 | Sediment | LIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTMRR |
| Ga0364943_0411601_2_142 | 3300034354 | Sediment | LIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTMGR |
| Ga0364941_042544_842_994 | 3300034417 | Sediment | LFRELIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR |
| ⦗Top⦘ |