NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095661

Metagenome / Metatranscriptome Family F095661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095661
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 44 residues
Representative Sequence RPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Number of Associated Samples 91
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 97.14 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.476 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.429 % of family members)
Environment Ontology (ENVO) Unclassified
(40.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.905 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.88%    β-sheet: 0.00%    Coil/Unstructured: 69.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF07992Pyr_redox_2 15.24
PF08241Methyltransf_11 4.76
PF12543DUF3738 2.86
PF00593TonB_dep_Rec 2.86
PF01522Polysacc_deac_1 1.90
PF01053Cys_Met_Meta_PP 1.90
PF09594GT87 0.95
PF00069Pkinase 0.95
PF00753Lactamase_B 0.95
PF10282Lactonase 0.95
PF13380CoA_binding_2 0.95
PF13533Biotin_lipoyl_2 0.95
PF07676PD40 0.95
PF01594AI-2E_transport 0.95
PF05974DUF892 0.95
PF14080DUF4261 0.95
PF00005ABC_tran 0.95
PF00890FAD_binding_2 0.95
PF00378ECH_1 0.95
PF02954HTH_8 0.95
PF13620CarboxypepD_reg 0.95
PF02900LigB 0.95
PF11937DUF3455 0.95
PF00571CBS 0.95
PF00196GerE 0.95
PF00390malic 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.81
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 1.90
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 1.90
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 1.90
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 1.90
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 1.90
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 1.90
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 1.90
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 1.90
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 1.90
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 1.90
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 1.90
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 1.90
COG0281Malic enzymeEnergy production and conversion [C] 0.95
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.95
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.48 %
UnclassifiedrootN/A9.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004463|Ga0063356_100477959All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300005093|Ga0062594_102009799All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005290|Ga0065712_10018594All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300005293|Ga0065715_10028784All Organisms → cellular organisms → Bacteria → Proteobacteria1946Open in IMG/M
3300005293|Ga0065715_10933797All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300005295|Ga0065707_10531844All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300005328|Ga0070676_11611456All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005343|Ga0070687_100396806All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300005344|Ga0070661_101198886All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005353|Ga0070669_101825418All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300005356|Ga0070674_101924167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium538Open in IMG/M
3300005364|Ga0070673_100481098All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300005365|Ga0070688_100743680All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005438|Ga0070701_10325398All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005440|Ga0070705_101422365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300005466|Ga0070685_10065974All Organisms → cellular organisms → Bacteria2132Open in IMG/M
3300005564|Ga0070664_102339595All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005577|Ga0068857_100316353All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300005616|Ga0068852_101371408All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005718|Ga0068866_10369640All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300005718|Ga0068866_10964478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300005840|Ga0068870_11316575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. LH128527Open in IMG/M
3300006237|Ga0097621_100409298All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300006846|Ga0075430_100235246All Organisms → cellular organisms → Bacteria → Proteobacteria1519Open in IMG/M
3300006881|Ga0068865_100692862All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300007004|Ga0079218_11868969All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300009030|Ga0114950_10990390All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300009139|Ga0114949_10316635All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1244Open in IMG/M
3300009139|Ga0114949_11351575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium569Open in IMG/M
3300009139|Ga0114949_11451524Not Available548Open in IMG/M
3300009156|Ga0111538_10325548All Organisms → cellular organisms → Bacteria → Acidobacteria1945Open in IMG/M
3300009156|Ga0111538_11088971Not Available1010Open in IMG/M
3300009156|Ga0111538_11182738All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300009162|Ga0075423_10120206All Organisms → cellular organisms → Bacteria2755Open in IMG/M
3300009162|Ga0075423_11712325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300009171|Ga0105101_10596218Not Available548Open in IMG/M
3300009553|Ga0105249_12345172All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300010304|Ga0134088_10474453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300011112|Ga0114947_10781382All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012173|Ga0137327_1142446All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012212|Ga0150985_106092093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300012232|Ga0137435_1104558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300012232|Ga0137435_1173038All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012285|Ga0137370_11016564All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012908|Ga0157286_10133492Not Available771Open in IMG/M
3300012910|Ga0157308_10240479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300013306|Ga0163162_13419315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300013308|Ga0157375_11238551All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300014326|Ga0157380_10335282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1408Open in IMG/M
3300014969|Ga0157376_10367193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1382Open in IMG/M
3300015200|Ga0173480_10137191All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300015374|Ga0132255_102076869All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300018077|Ga0184633_10082277All Organisms → cellular organisms → Bacteria → Proteobacteria1657Open in IMG/M
3300018078|Ga0184612_10373697All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300018429|Ga0190272_12723215All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria544Open in IMG/M
3300018469|Ga0190270_10170627All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300018469|Ga0190270_10827815All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300018476|Ga0190274_12040774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300018481|Ga0190271_10568995All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300018481|Ga0190271_12330513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium640Open in IMG/M
3300019248|Ga0180117_1205023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_211035Open in IMG/M
3300019377|Ga0190264_10293290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium979Open in IMG/M
3300019377|Ga0190264_10407142Not Available885Open in IMG/M
3300022756|Ga0222622_10222029All Organisms → cellular organisms → Bacteria → Acidobacteria1266Open in IMG/M
3300024060|Ga0209987_10331846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium843Open in IMG/M
3300024431|Ga0209988_10312304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium891Open in IMG/M
3300024516|Ga0209980_10408333Not Available583Open in IMG/M
3300025885|Ga0207653_10402735All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300025908|Ga0207643_10752269All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300025910|Ga0207684_10759312All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300025920|Ga0207649_10396568All Organisms → cellular organisms → Bacteria → Acidobacteria1032Open in IMG/M
3300025920|Ga0207649_10874955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300025926|Ga0207659_11189878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300025930|Ga0207701_11693872All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025931|Ga0207644_11009825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300025933|Ga0207706_11283381All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300025937|Ga0207669_10352196All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300025938|Ga0207704_10510136All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300025942|Ga0207689_10997615All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300025949|Ga0207667_11354297All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300026041|Ga0207639_10830803Not Available862Open in IMG/M
3300026088|Ga0207641_10318827All Organisms → cellular organisms → Bacteria → Acidobacteria1473Open in IMG/M
3300026118|Ga0207675_100458628All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300026121|Ga0207683_10345099All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300027637|Ga0209818_1064685All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300027876|Ga0209974_10472122All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027909|Ga0209382_10135783All Organisms → cellular organisms → Bacteria2860Open in IMG/M
3300028380|Ga0268265_12086993All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300028803|Ga0307281_10163116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300031538|Ga0310888_10978326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella immobilis531Open in IMG/M
3300031824|Ga0307413_10268971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1275Open in IMG/M
3300031847|Ga0310907_10399254Not Available716Open in IMG/M
3300031908|Ga0310900_10851175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300031911|Ga0307412_12105910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300032000|Ga0310903_10517738All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032005|Ga0307411_11817065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300032013|Ga0310906_10185283All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300032013|Ga0310906_10408854Not Available898Open in IMG/M
3300032211|Ga0310896_10108115Not Available1257Open in IMG/M
3300033550|Ga0247829_10981665All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300033550|Ga0247829_11618735All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300034148|Ga0364927_0237959All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300034149|Ga0364929_0024427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1761Open in IMG/M
3300034354|Ga0364943_0411601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300034417|Ga0364941_042544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.57%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface7.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.95%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009030Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaGEnvironmentalOpen in IMG/M
3300009139Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300011112Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaGEnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024060Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024431Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024516Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063356_10047795913300004463Arabidopsis Thaliana RhizosphereLVEKHGARPRYKQSPGHNHSSQLLSVGTPDASVSRELVDFIERTVRR*
Ga0062594_10200979933300005093SoilPRYTQSPGHNHSSQLWSLGTSDTSVSRELVDFIERTVKR*
Ga0065712_1001859413300005290Miscanthus RhizosphereHKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR*
Ga0065715_1002878413300005293Miscanthus RhizosphereGARPRYKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR*
Ga0065715_1093379723300005293Miscanthus RhizosphereAAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0065707_1053184433300005295Switchgrass RhizosphereLFKELLEKQARPRYRQSLGHNHVSQVLSVGTVDTSMSREVLDFIDRTIRR*
Ga0070676_1161145613300005328Miscanthus RhizospherePRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK*
Ga0070687_10039680613300005343Switchgrass RhizosphereARPRYRQSLGHNHSSQLLSFGTGDTSVSRELVDFIETVIKR*
Ga0070661_10119888613300005344Corn RhizosphereVMPRYRQSLGHNHVSQLLSIGTVDTSISREILDFIDRVIHPVK*
Ga0070669_10182541813300005353Switchgrass RhizosphereAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0070674_10192416713300005356Miscanthus RhizosphereARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH*
Ga0070673_10048109823300005364Switchgrass RhizosphereYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK*
Ga0070688_10074368013300005365Switchgrass RhizosphereELIDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR*
Ga0070701_1032539813300005438Corn, Switchgrass And Miscanthus RhizosphereRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK*
Ga0070705_10142236523300005440Corn, Switchgrass And Miscanthus RhizosphereEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTIRR*
Ga0070685_1006597423300005466Switchgrass RhizosphereVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK*
Ga0070664_10233959523300005564Corn RhizosphereYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVVHPVK*
Ga0068857_10031635323300005577Corn RhizospherePRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVVHPVK*
Ga0068852_10137140813300005616Corn RhizosphereKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR*
Ga0068866_1036964023300005718Miscanthus RhizosphereVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0068866_1096447813300005718Miscanthus RhizosphereSLGHNHVSQLLSVGTADTSISREILDFIDRVTTG*
Ga0068870_1131657513300005840Miscanthus RhizosphereEHGVVPRYLQSLGHNHSSQLLSVGTADRSVSATIVDFIERTVHSR*
Ga0097621_10040929813300006237Miscanthus RhizosphereRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK*
Ga0075430_10023524633300006846Populus RhizosphereSLGHNHVSQLLSVGTADTSVSREILDFVEQVTALSHTP*
Ga0068865_10069286213300006881Miscanthus RhizosphereFSELVEKHHVKPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK*
Ga0079218_1186896913300007004Agricultural SoilPRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTLAR*
Ga0114950_1099039023300009030Deep SubsurfaceFAALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR*
Ga0114949_1031663523300009139Deep SubsurfaceLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR*
Ga0114949_1135157513300009139Deep SubsurfaceAALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR*
Ga0114949_1145152413300009139Deep SubsurfaceKQSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR*
Ga0111538_1032554823300009156Populus RhizosphereFKELLEKNARPRYRQSLGHNHVSQLLSVGTADTSVTREVLDFIDRTLKTPPR*
Ga0111538_1108897113300009156Populus RhizosphereRPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR*
Ga0111538_1118273833300009156Populus RhizosphereFKELLEKNARPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVAGH*
Ga0075423_1012020643300009162Populus RhizospherePRYKQSPGHNHSSQLWSLGTSDTSVSRELVDFIERTVKR*
Ga0075423_1171232523300009162Populus RhizosphereQAAVYKELIDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR*
Ga0105101_1059621813300009171Freshwater SedimentRYPGPFAELFRELVEKHDARPRFRQSLGHTHTSQLLSIGTVDTSVSREILDFIDRIVGR*
Ga0105249_1234517213300009553Switchgrass RhizosphereSPGHNHSSQLLSVGTPDTSVSSELVDFIERTVTRAE*
Ga0134088_1047445313300010304Grasslands SoilTELVEKHQARPRYRQSLGHNHVSQLLSMGTVASSVSREILDFIDRIVGR*
Ga0114947_1078138223300011112Deep SubsurfaceLAFAALLEELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSGELVDFIERTIGR*
Ga0137327_114244613300012173SoilLQSLGHNHSSQLLSVGTADESVSSIIVDFIERTGSR*
Ga0150985_10609209313300012212Avena Fatua RhizosphereVQKHGMRPRFRQSLGHNHVSQLLSVGTADTSISREILDFIDRVTTR*
Ga0137435_110455813300012232SoilARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR*
Ga0137435_117303813300012232SoilHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0137370_1101656413300012285Vadose Zone SoilVMPRYRQSLGHNHVSQLLSVGTSDTSVSREILDFINRVIGG*
Ga0157286_1013349223300012908SoilRELVEKHGARPRYKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR*
Ga0157308_1024047913300012910SoilAAVYNELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVKR*
Ga0163162_1341931523300013306Switchgrass RhizosphereELVEKHRARPRYKQSPGHNHSSQLLSVGTADTSVSRELVDFIERTVTR*
Ga0157375_1123855123300013308Miscanthus RhizosphereQAAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0157380_1033528213300014326Switchgrass RhizosphereSLGHNHSSQLLSLGTADRSVSGIIVDFIERTGSR*
Ga0157376_1036719313300014969Miscanthus RhizosphereLVLKHAVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK*
Ga0173480_1013719113300015200SoilEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0132255_10207686923300015374Arabidopsis RhizosphereVEKHQARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR*
Ga0184633_1008227743300018077Groundwater SedimentRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRIVRR
Ga0184612_1037369723300018078Groundwater SedimentLIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR
Ga0190272_1272321523300018429SoilFEELVIEHGVVPRYKQSLGHNHSSQLLSVGTADTSVSAEVVDFIERTSGR
Ga0190270_1017062713300018469SoilARPRYRQSLGHNHVSQLLSMGTVDTSVSREILDFIDRTLGH
Ga0190270_1082781513300018469SoilHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR
Ga0190274_1204077413300018476SoilGARPRYRQSIGHNHSSQLLSVGTPDTSVSRELVDFIERTVTR
Ga0190271_1056899513300018481SoilERHGARPRYRQSLGHNHSSQLLSVGTSDTSVSRELVDFIERTVKR
Ga0190271_1233051313300018481SoilQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Ga0180117_120502313300019248Groundwater SedimentEAQLFKELLEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREVLDFIDRTIRR
Ga0190264_1029329013300019377SoilLYKELVEKHGARPRYPQSLGHNHVSQLLSMGTVDASVSREILDFIDRTVGR
Ga0190264_1040714223300019377SoilYRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTIKH
Ga0222622_1022202933300022756Groundwater SedimentQSLGHNHSSQLLSVGTPDTSVSRELVDFIERVVKH
Ga0209987_1033184613300024060Deep SubsurfaceELVVGHGVMPRYKQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR
Ga0209988_1031230413300024431Deep SubsurfaceQSLGHNHTSQLLAIGTADTGVSAELVDFIERTVGR
Ga0209980_1040833323300024516Deep SubsurfaceQSLGHNHTSQLLAIGTADTGVSAVLVDFIERTVGR
Ga0207653_1040273513300025885Corn, Switchgrass And Miscanthus RhizosphereLVQKHGMRPRFRQSLGHNHVSQLLSVGTADTSISREIVDFIDRVPAR
Ga0207643_1075226923300025908Miscanthus RhizosphereVLKHAVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK
Ga0207684_1075931223300025910Corn, Switchgrass And Miscanthus RhizosphereAVMPRYRQSLGHNHVSQLLSIGTVDTSVSREILDFIDRVIHPVK
Ga0207649_1039656813300025920Corn RhizosphereLKHAVMPRYRQSLGHNHVSQLLSIGTVDTSISREILDFIDRVIHPVK
Ga0207649_1087495523300025920Corn RhizosphereVLKHGVKPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK
Ga0207659_1118987823300025926Miscanthus RhizosphereGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH
Ga0207701_1169387223300025930Corn, Switchgrass And Miscanthus RhizosphereRPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Ga0207644_1100982513300025931Switchgrass RhizosphereRQSLGHNHVSQLLSVGTADTSISREILDFIDRVTAR
Ga0207706_1128338123300025933Corn RhizosphereAVYNELVEKHKARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVRR
Ga0207669_1035219613300025937Miscanthus RhizosphereAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR
Ga0207704_1051013623300025938Miscanthus RhizosphereKHGVRPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK
Ga0207689_1099761513300025942Miscanthus RhizosphereLVDKHGARPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKH
Ga0207667_1135429733300025949Corn RhizosphereRQSLGHNHVSQLLSVGTADTSISREILDFIDRMRPR
Ga0207639_1083080313300026041Corn RhizosphereKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR
Ga0207641_1031882723300026088Switchgrass RhizosphereKHGVMPRYRQSLGHNHVSQLLSLGTVDTSVSREILDFIDRVIHPVK
Ga0207675_10045862823300026118Switchgrass RhizospherePQAAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVTR
Ga0207683_1034509923300026121Miscanthus RhizosphereKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTVKR
Ga0209818_106468523300027637Agricultural SoilPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Ga0209974_1047212213300027876Arabidopsis Thaliana RhizosphereTPRYLQSLGHNHSSQLLSLGTADRSVSGIIVDFIERTGSR
Ga0209382_1013578343300027909Populus RhizosphereRPRYRQSLGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Ga0268265_1208699313300028380Switchgrass RhizosphereAVYDELVEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR
Ga0307281_1016311613300028803SoilLFTELIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTTRR
Ga0310888_1097832613300031538SoilLVVEHGVVPRYLQSLGHNHSSQLLSVGTADRSVSGTIVDFIERTVHSR
Ga0307413_1026897123300031824RhizospherePRYFQSLGHNHSSQLLSVGTQDQSVSGIIIDFIERTGGR
Ga0310907_1039925413300031847SoilYRELIDKHGARPRYRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTSTH
Ga0310900_1085117523300031908SoilRELIDKHGARPRYRQSLGHNHSSQLLSVGTADTSVSRELVDFIERTAKN
Ga0307412_1210591023300031911RhizosphereGARPRYRQSLGHNHSSQLFSVGTADTSVSRELVDFIERTVKR
Ga0310903_1051773813300032000SoilEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSREMVDFIERTITR
Ga0307411_1181706523300032005RhizosphereEKHGARPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERNVRR
Ga0310906_1018528313300032013SoilPRYKQSPGHNHSSQLLSVGTADTSVSRELVDFIERTVTR
Ga0310906_1040885413300032013SoilYKQSPGHNHSSQLLSVGTADTTVSRELVDFIERTVKR
Ga0310896_1010811523300032211SoilLVEKHGARPRYKQSPGHNHSSQLLSVGTPDTSVSRELVDFIERTVKR
Ga0247829_1098166513300033550SoilEKHKARPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTITR
Ga0247829_1161873513300033550SoilAALFAELVTEHGATPRYLQSLGHNHSSQLLSVGTSDQSVSGVIVDFIERTGGR
Ga0364927_0237959_380_5353300034148SedimentVYNELVEKHNGRPRYKQSPGHNHSSQLLSLGTPDTSVSRELVDFIERTITR
Ga0364929_0024427_3_1433300034149SedimentLIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTMRR
Ga0364943_0411601_2_1423300034354SedimentLIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTMGR
Ga0364941_042544_842_9943300034417SedimentLFRELIEKNARPRYRQSLGHNHVSQLLSVGTADTSVSREILDFIDRTLRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.