 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F095637 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 47 residues |
| Representative Sequence | IRPTVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 95.24 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.857 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.381 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.476 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 4.76 |
| PF13432 | TPR_16 | 3.81 |
| PF00034 | Cytochrom_C | 2.86 |
| PF13414 | TPR_11 | 1.90 |
| PF03712 | Cu2_monoox_C | 1.90 |
| PF04307 | YdjM | 0.95 |
| PF01765 | RRF | 0.95 |
| PF00152 | tRNA-synt_2 | 0.95 |
| PF13561 | adh_short_C2 | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF14833 | NAD_binding_11 | 0.95 |
| PF02371 | Transposase_20 | 0.95 |
| PF07626 | PSD3 | 0.95 |
| PF01872 | RibD_C | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0233 | Ribosome recycling factor | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.95 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.95 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.95 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.86 % |
| All Organisms | root | All Organisms | 37.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062591_1009169371 | 3300004643 | Soil | TVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0062594_1023598521 | 3300005093 | Soil | RFSRTIRTGKTTVRPTVSIYNLTNSNAVQTYSNTYGASWQTPLTIMQSRFVDIGVQVDF* |
| Ga0070670_1018983662 | 3300005331 | Switchgrass Rhizosphere | FRSGGTVIRPTVSIYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF* |
| Ga0070666_105570642 | 3300005335 | Switchgrass Rhizosphere | IRPTVSIYNLFNSNAVQTYVNTYGATWLNPTVIMQARFVDIGVQVDF* |
| Ga0070669_1003513232 | 3300005353 | Switchgrass Rhizosphere | RFSKTIRYGQTSIRPTVSVYNLFNSNAVQTYVNTYGGTWLNPTVIMQARFVDIGVQVDF* |
| Ga0070671_1004231161 | 3300005355 | Switchgrass Rhizosphere | SIYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF* |
| Ga0070688_1003037631 | 3300005365 | Switchgrass Rhizosphere | NLFNSNPVQTYTNTYGLAWQAPQTILQSRFVDIGMQVDF* |
| Ga0070659_1002628852 | 3300005366 | Corn Rhizosphere | IRPTVSIYNLFNANPIQTYNATYGSAWLSPTVIMQARFIDIGVQVDF* |
| Ga0070667_1020480692 | 3300005367 | Switchgrass Rhizosphere | PTVSIYNLFNANPVQTYVTTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0070700_1010778861 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FSRTIRTGHTTVRPTVSVYNLFNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0070694_1010036632 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF* |
| Ga0070678_1008288692 | 3300005456 | Miscanthus Rhizosphere | TTIRPTVSIYNLFNANPVQTYVTTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0070662_1005155952 | 3300005457 | Corn Rhizosphere | SKAFRSGGTVIRPTVSIYNLFNANPIQTYNTTYGSAWLAPTVIMQARFIDIGVQVDF* |
| Ga0070699_1017228731 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF* |
| Ga0070704_1015940841 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FTRALRTGRTVVRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0070704_1016943011 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0066699_107097661 | 3300005561 | Soil | RPTINFYNLFNANPIQTYTNTFGAAWLAPLVILNPRFMDVGVQIDF* |
| Ga0068857_1019552392 | 3300005577 | Corn Rhizosphere | SIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0068859_1013839341 | 3300005617 | Switchgrass Rhizosphere | IYNLFNSNAVQTYVNTYGATWLNPTVIMQARFVDIGVQVDF* |
| Ga0068864_1007083941 | 3300005618 | Switchgrass Rhizosphere | IRTGHTVVRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0068861_1002132172 | 3300005719 | Switchgrass Rhizosphere | TVIRPTFSVYNLFNANPIQTYNTTYGSAWLAPTVIMQARFWDIGVQVDF* |
| Ga0068861_1008119392 | 3300005719 | Switchgrass Rhizosphere | PTISVYNLFNANPIQTYTQTFGAAWLAPTVILNPRFMDFGVQIDF* |
| Ga0066903_1058891662 | 3300005764 | Tropical Forest Soil | VSVYNLFNSNAIQTYNNTYGGAWQAPQSIMQSRFVDIGVQVDF* |
| Ga0068860_1025037232 | 3300005843 | Switchgrass Rhizosphere | VRPTVSVYNLFNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0068862_1004193821 | 3300005844 | Switchgrass Rhizosphere | RPTVSIYNLFNANPIQTYNTTYGSAWLAPTVIMQARFIDIGVQVDF* |
| Ga0075432_103752442 | 3300006058 | Populus Rhizosphere | VNHGRTVVRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF* |
| Ga0097621_1019341702 | 3300006237 | Miscanthus Rhizosphere | TSIRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFIDIGVQVDF* |
| Ga0097621_1022871122 | 3300006237 | Miscanthus Rhizosphere | TTVRPTVSVYNLFNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0068871_1018282932 | 3300006358 | Miscanthus Rhizosphere | SVYNLFNANPIQTYNTTYGSAWLAPTVIMQARFWDIGVQVDF* |
| Ga0075431_1015667662 | 3300006847 | Populus Rhizosphere | VRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0075433_104667691 | 3300006852 | Populus Rhizosphere | IRFSRTIRTGKTTIRPTVSIYNLNNSNAVQTYSNTYGASWQTPLTIMQSRFVDVGVQVDF |
| Ga0075433_105558862 | 3300006852 | Populus Rhizosphere | IYNLFNANPVQTYTNTYGSAWQAPQTILQSRFIDIGMQVDF* |
| Ga0075420_1003384851 | 3300006853 | Populus Rhizosphere | SIYNLFNANPIQTYNVSYGAAWLAPTVIMQARFVDIGVQVDF* |
| Ga0075420_1018603501 | 3300006853 | Populus Rhizosphere | VRPTVSVYNLFNSNAVQTYSNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0075425_1025646552 | 3300006854 | Populus Rhizosphere | YNLFNSNAIQTYSNTYGTSWQTPLSIMQSRFVDIGVQMDF* |
| Ga0075429_1009796641 | 3300006880 | Populus Rhizosphere | NLFNANPVQTYNLTFGSAWLAPTVILQSRFVDIGVQVDF* |
| Ga0068865_1019239511 | 3300006881 | Miscanthus Rhizosphere | SIYNLFNANPIQTYTLTYGAAWLAPTVILNPRFMDFGVQIDF* |
| Ga0075419_1000594210 | 3300006969 | Populus Rhizosphere | KTTIRPTVSIYNLNNSNAVQTYSNTYGASWQTPLTIMQSRFVDVGVQVDF* |
| Ga0079218_114222021 | 3300007004 | Agricultural Soil | TTVRPTVSIYNLFNANPVQTYNLTYGSAWLAPTVILQSRFVDLGVQVDF* |
| Ga0105107_101149231 | 3300009087 | Freshwater Sediment | TLSVYNLFNANPVQTYNLTYGSAWLAPTVIMQSRFVDIGVQVDF* |
| Ga0105245_103254972 | 3300009098 | Miscanthus Rhizosphere | RSGGTVIRPTFSVYNLFNANPIQTYNTTYGSAWLSPTVIMQARFWDIGVQVDF* |
| Ga0075418_105111541 | 3300009100 | Populus Rhizosphere | NLFNANPVQTYNTTYGAAWLSPTVILQARFWDIGVQVDF* |
| Ga0114129_106967441 | 3300009147 | Populus Rhizosphere | IRPTVSIYNLFNSNAVQTYVNTYGGTWLNPTVIMQARFVDIGVQVDF* |
| Ga0075423_104820561 | 3300009162 | Populus Rhizosphere | NPIQTYNTTYGSAWLSPTVIMQARFWDIGVQVDF* |
| Ga0105248_106760762 | 3300009177 | Switchgrass Rhizosphere | YNLFNANPVQTYVTTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0105249_1000503710 | 3300009553 | Switchgrass Rhizosphere | FNANPIQTYNTTYGSAWLSPTVIMQARFWDIGVQVDF* |
| Ga0105249_113124532 | 3300009553 | Switchgrass Rhizosphere | FNANPVQTYNTTYGAAWLSPTVIMQARFWDIGVQVDF* |
| Ga0105252_105368211 | 3300009678 | Soil | SNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0126310_113831002 | 3300010044 | Serpentine Soil | VLRNGRTVVRPTVSIYNLFNANPVQTYTSTLSQWLAPQVILQSRFADVGVQIDF* |
| Ga0134127_113230342 | 3300010399 | Terrestrial Soil | VSIYNLFNANPIQTYNTTYGAAWLAPTVILQARFVDIGVQVDF* |
| Ga0105246_114080801 | 3300011119 | Miscanthus Rhizosphere | QTSIRPTVSIYNLFNANPVQTYVTNPYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0137435_10207701 | 3300012232 | Soil | RAIRSGRTMIRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0150984_1196528962 | 3300012469 | Avena Fatua Rhizosphere | SIYNLFNANPIQTYNTTFGPAWLAPTVILQSRFADLGVQVDF* |
| Ga0157304_10609211 | 3300012882 | Soil | VIRPTFSVYNLFNANPIQTYNTTYGSAWLSPTVIMQARFWDIGVQVDF* |
| Ga0157291_100903642 | 3300012902 | Soil | TRAIRTGRTVVRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGLQVDF* |
| Ga0163162_112478971 | 3300013306 | Switchgrass Rhizosphere | QTSIRPTVSIYNLFNSNAVQTYVNTYGATWLNPTVIMQARFVDIGVQVDF* |
| Ga0180077_10853871 | 3300015255 | Soil | TTIRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF* |
| Ga0132256_1018255161 | 3300015372 | Arabidopsis Rhizosphere | VRPTVSVYNLFNSNAVQTYNNTYGLAWQAPQTIMQSRFVDIGVQVDF* |
| Ga0163161_113500391 | 3300017792 | Switchgrass Rhizosphere | FSVYNLFNANPIQTYNTTYGSAWLAPTVIMQARFWDIGVQVDF |
| Ga0184628_104769332 | 3300018083 | Groundwater Sediment | VIRPTVSVYNLFNANPIQTYNATYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0190274_113351092 | 3300018476 | Soil | YNLFNANPIQTYNTTYGAAWLSPTVIMQARFIDIGVQVDF |
| Ga0210380_105305292 | 3300021082 | Groundwater Sediment | RTGHTTVRPTVSVYNLFNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF |
| Ga0247792_11442102 | 3300022880 | Soil | TVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF |
| Ga0207682_100307831 | 3300025893 | Miscanthus Rhizosphere | TVSIYKLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0207688_105426052 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TIRPTVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Ga0207680_105003781 | 3300025903 | Switchgrass Rhizosphere | TSIRPTVSIYNLFNSNAVQTYVNTYGATWLNPTVIMQARFVDIGVQVDF |
| Ga0207681_102646331 | 3300025923 | Switchgrass Rhizosphere | GTVIRPTVSIYNLFNANPIQTYNTTYGSAWLAPTVIMQARFIDIGVQVDF |
| Ga0207681_103407272 | 3300025923 | Switchgrass Rhizosphere | RFSKTIRYGQTSIRPTVSVYNLFNSNAVQTYVNTYGGTWLNPTVIMQARFVDIGVQVDF |
| Ga0207681_109222052 | 3300025923 | Switchgrass Rhizosphere | STTVNHGRTVVRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF |
| Ga0207650_106351891 | 3300025925 | Switchgrass Rhizosphere | PTVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Ga0207650_115121171 | 3300025925 | Switchgrass Rhizosphere | ANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0207659_101762692 | 3300025926 | Miscanthus Rhizosphere | IRPTVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Ga0207687_111422221 | 3300025927 | Miscanthus Rhizosphere | IYNLFNANPIQTYVNTYGATWQNPTVILQARFVDVGVQIDF |
| Ga0207644_113142461 | 3300025931 | Switchgrass Rhizosphere | RPTVSIYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0207670_101120442 | 3300025936 | Switchgrass Rhizosphere | VLRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGMQVDF |
| Ga0207691_105066491 | 3300025940 | Miscanthus Rhizosphere | IRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0207691_108299101 | 3300025940 | Miscanthus Rhizosphere | IRSGGTVIRPTVSIYNLFNANPVQTYVTTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0207679_101421212 | 3300025945 | Corn Rhizosphere | NLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF |
| Ga0207712_114877291 | 3300025961 | Switchgrass Rhizosphere | TVSIYNLFNANPVQTYVTTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0207712_120788551 | 3300025961 | Switchgrass Rhizosphere | PTVSVYNLFNSNAVQTYVNTYGGTWLNPTVIMQARFVDIGVQVDF |
| Ga0207677_102443992 | 3300026023 | Miscanthus Rhizosphere | TVRPTVSVYNLFNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF |
| Ga0207678_107117233 | 3300026067 | Corn Rhizosphere | LFNANPVQTYTNTYGSAWQAPQTILQSRFIDIGMQVDF |
| Ga0207641_103235651 | 3300026088 | Switchgrass Rhizosphere | YGTTTIRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0207676_106676222 | 3300026095 | Switchgrass Rhizosphere | IRTGHTVVRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVDF |
| Ga0207674_102076391 | 3300026116 | Corn Rhizosphere | IYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0207675_1017493861 | 3300026118 | Switchgrass Rhizosphere | TTIRPTVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Ga0209706_100672901 | 3300027818 | Freshwater Sediment | TLSVYNLFNANPVQTYNLTYGSAWLAPTVIMQSRFVDIGVQVDF |
| Ga0209481_104376102 | 3300027880 | Populus Rhizosphere | VVNHGRTVLRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF |
| Ga0209486_100494632 | 3300027886 | Agricultural Soil | GGTVIRPTVSIYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0268265_110258132 | 3300028380 | Switchgrass Rhizosphere | RPTVSIYNLFNSNPVQTYTNTYGLAWQAPQTILQSRFVDIGMQVDF |
| Ga0268264_105428141 | 3300028381 | Switchgrass Rhizosphere | RPTVSIYNLFNSNAVQTYVNTYGATWLNPTVIMQARFVDIGVQVDF |
| Ga0268264_106830491 | 3300028381 | Switchgrass Rhizosphere | KAIRSGGTVIRPTFSVYNLFNANPIQTYNTTYGSAWLAPTVIMQARFWDIGVQVDF |
| Ga0307503_100795152 | 3300028802 | Soil | TVSVYNLFNANPIQTYNTTYGSAWLSPTVIMQARFIDIGVQVDF |
| Ga0310888_107791231 | 3300031538 | Soil | NLFNANPVQTYVTTYGGTWLNPTVILQARFIDIGVQVDF |
| Ga0307405_119051101 | 3300031731 | Rhizosphere | LFNSNAVQTYNQTFGPAWLSPVVIMQSRFADIGVQVDF |
| Ga0310904_104139762 | 3300031854 | Soil | RFSTVVNHGRTVLRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGMQVDF |
| Ga0310904_112217081 | 3300031854 | Soil | GTVIRPTFSVYNLFNANPIQTYNTTYGSAWLAPTVIMQARFWDIGVQVDF |
| Ga0310892_100527861 | 3300031858 | Soil | FNSNAVQTYTNTYGLAWQAPQTIMQSRFVDIGVQVDF |
| Ga0310900_117240871 | 3300031908 | Soil | QIRYGTTTIRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF |
| Ga0310884_107172391 | 3300031944 | Soil | TVSIYNLFNANPVQTYNTTYGSAWLAPTVIMQARFVDIGVQVDF |
| Ga0307416_1030779651 | 3300032002 | Rhizosphere | RAIIRPTVSIYNLFNANPVQAYTTTYGSAWLAPQVILQSRFADIGVQVDF |
| Ga0310897_105410892 | 3300032003 | Soil | DIRFTRAIRTGHTVVRPTVSVYNLFNSNAVQTYTNNYGPAWQAPQTIMQSRFVDIGVQVD |
| Ga0307471_1009203352 | 3300032180 | Hardwood Forest Soil | VVNHGHTVLRPTVSIYNLFNANPIQTYTFGYSQWLAPQVILQSRFVDVGVQVDF |
| Ga0247830_114708162 | 3300033551 | Soil | SKAIRSGGTVIRPTFSVYNLFNANPVQAYNTNYGSAWLAPAVIMQARFWDIGVQVDF |
| Ga0364925_0028967_1654_1809 | 3300034147 | Sediment | GSTTIRPTVSIYNLFNANPVQTYVNTYGATWLNPTVILQARFVDIGVQVDF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |