| Basic Information | |
|---|---|
| Family ID | F095563 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNTIKLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.35 % |
| % of genes near scaffold ends (potentially truncated) | 37.14 % |
| % of genes from short scaffolds (< 2000 bps) | 51.43 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.952 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.905 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13673 | Acetyltransf_10 | 12.38 |
| PF00082 | Peptidase_S8 | 7.62 |
| PF09694 | Gcw_chp | 6.67 |
| PF00127 | Copper-bind | 5.71 |
| PF06035 | Peptidase_C93 | 4.76 |
| PF11953 | DUF3470 | 3.81 |
| PF05488 | PAAR_motif | 1.90 |
| PF01764 | Lipase_3 | 1.90 |
| PF00970 | FAD_binding_6 | 1.90 |
| PF00578 | AhpC-TSA | 1.90 |
| PF00175 | NAD_binding_1 | 1.90 |
| PF00583 | Acetyltransf_1 | 1.90 |
| PF13847 | Methyltransf_31 | 0.95 |
| PF03332 | PMM | 0.95 |
| PF10902 | WYL_2 | 0.95 |
| PF07486 | Hydrolase_2 | 0.95 |
| PF03567 | Sulfotransfer_2 | 0.95 |
| PF02675 | AdoMet_dc | 0.95 |
| PF13508 | Acetyltransf_7 | 0.95 |
| PF08241 | Methyltransf_11 | 0.95 |
| PF00733 | Asn_synthase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 4.76 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 1.90 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.95 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.95 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.95 % |
| All Organisms | root | All Organisms | 19.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.52% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.57% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.57% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.71% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.76% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.86% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 2.86% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.95% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.95% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.95% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.95% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.95% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005234 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_100m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000131523 | 3300000101 | Marine | MNTIKLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM* |
| DelMOSum2010_100297847 | 3300000101 | Marine | MNTIKLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM* |
| LPjun09P1210mDRAFT_10009744 | 3300000168 | Marine | MGSDVEMRAVALTIIDKSGIFKKVDQKLEALCYAMLWGSWFLCLTQLF* |
| OpTDRAFT_100497155 | 3300000928 | Freshwater And Marine | MNTIKLVIDKSGIFKKVDQKMEALCYAMLWGSMFLCMSQLAYM* |
| JGI24003J15210_100130237 | 3300001460 | Marine | MNTIKLVIDKSGIFKKVDQKLEVLCYAMLWGSMFLCMSQIFTL* |
| JGI24005J15628_100770482 | 3300001589 | Marine | MKAVALTIIDKSGITKKVTEKVETLCYAMLWGSWFICLAQIF* |
| Ga0065861_11134933 | 3300004448 | Marine | MTIIAKIVDKTGIFKKLDQKAETFCYALLWSSMFICLAQMF* |
| Ga0065861_11974223 | 3300004448 | Marine | MNTIKLVIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM* |
| Ga0066613_14065303 | 3300005234 | Marine | MNTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM* |
| Ga0066830_100000844 | 3300005433 | Marine | MNTIKLVIDKSGIFKKVDQKIETLCYAMLWGSMFVCMSQLAYM* |
| Ga0070722_100759913 | 3300005601 | Marine Sediment | MNTIKLVINKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM* |
| Ga0078893_129278433 | 3300005837 | Marine Surface Water | MNTIKLVIDKSGIFKKVDQKVEVLCYAMLWGSMFVCMSQLAYM* |
| Ga0070742_100090233 | 3300005942 | Estuarine | MNTIRLVVDKSGILKKIDHKVEILCYAMLWGAWFLCLAQL* |
| Ga0075502_14619541 | 3300006357 | Aqueous | MNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLTYM* |
| Ga0075503_15927651 | 3300006400 | Aqueous | MNTIRLVIDKSGIFKKVDQKLEALCYTMLWGSMFLCMSQLAYM* |
| Ga0070744_100731301 | 3300006484 | Estuarine | MKTIALTIIDKSGILKKVDQKVEALCYAMLWGSWFLCLTQLF* |
| Ga0070754_101589203 | 3300006810 | Aqueous | MNTIKVVIDKTGIFKKVDQKLEALCYAMLWGSMFLCMSQLTYM* |
| Ga0075477_102183621 | 3300006869 | Aqueous | MNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLAYM* |
| Ga0070747_11423403 | 3300007276 | Aqueous | MNTIKLVINKSGIFKKVDQKLEALCYAMLWGSMFLCMS |
| Ga0115371_107729162 | 3300008470 | Sediment | MNTIKLVINKSGIFKKIDQKMEALCYFMLWGLMFLCLAQVAYI* |
| Ga0115371_112549772 | 3300008470 | Sediment | MNTIKIVIDKSGIFKKIDRKAEAFCYAMLWGSMFICIAQIAYM* |
| Ga0115371_113638262 | 3300008470 | Sediment | MNTIKLVIDKTGIFKKVDQKLEALCYAMLWGLMFICMAQIFYM* |
| Ga0102854_10110327 | 3300009058 | Estuarine | NTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM* |
| Ga0102830_12619041 | 3300009059 | Estuarine | THTYGEHMNTIRLVVDKSGILKKIDHKVEILCYAMLWGAWFLCLAQL* |
| Ga0102814_102560864 | 3300009079 | Estuarine | VTLVYKFIDKSGVFKKTGDKLEALCYALLWGSWFLCLSVLFG |
| Ga0114995_100011791 | 3300009172 | Marine | KSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM* |
| Ga0114998_100109105 | 3300009422 | Marine | MNTIKLVVDKSGIFKKGTQKIEFLCYAMFWGAWILCLAQL* |
| Ga0115547_12279823 | 3300009426 | Pelagic Marine | MNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM* |
| Ga0114915_10113697 | 3300009428 | Deep Ocean | MNTIKLVIDKSGIFKKVDQKLEALCYFMLWGSMFICMAQIAYI* |
| Ga0114915_11823461 | 3300009428 | Deep Ocean | TQITYRRIMNTIKLVIDKSGIFKKIDRKAEAFCYAMLWGSMFICIAQIAYM* |
| Ga0115545_10928603 | 3300009433 | Pelagic Marine | MNTIKLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLAYM* |
| Ga0115556_12441322 | 3300009437 | Pelagic Marine | MNTIKLVIDKSGIFKKFEQKLEALCYTMLWGSMFLCMSQLAYM* |
| Ga0115557_10842251 | 3300009443 | Pelagic Marine | MNTIKLVIDKSGIFKKFEQKLEALCYTMLWGSMFL |
| Ga0115571_100162213 | 3300009495 | Pelagic Marine | MNTVRLVVDKSGILKKIDHKVEILCYAMLWGAWFLCLAQL* |
| Ga0115570_100577975 | 3300009496 | Pelagic Marine | IMNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM* |
| Ga0115003_100595335 | 3300009512 | Marine | MIRTIIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIA |
| Ga0115000_100035011 | 3300009705 | Marine | MIRTIIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM* |
| Ga0133547_112386002 | 3300010883 | Marine | MIRTIIDKSGIFKKVDRKAETFCYALLWGSMFVCMAQIAYM* |
| Ga0164321_102228813 | 3300014903 | Marine Sediment | MNTIKLVIDKSGIFKKVDQKIEALCYAMLWGSMFVCMSQLAYM* |
| Ga0180120_103164864 | 3300017697 | Freshwater To Marine Saline Gradient | KLVINKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0181377_10491033 | 3300017706 | Marine | MGSDVEMRTIALTIIDKSGIFKKVHQKAEVLCYAMLWGSWFLCLTALF |
| Ga0181387_10166322 | 3300017709 | Seawater | MTAVALKIIDKSGIFKKVHQKAEVLCYTMLWGSWFLC |
| Ga0181412_10757771 | 3300017714 | Seawater | ALKIIDKSGIFKKVHQKAEVLCYTMLWGSWFLCLTQLF |
| Ga0181390_10360682 | 3300017719 | Seawater | MGSDVEMRAVALTIIDKSGIFKKVHQKAEVLCYTMLWGSWFLCLTQLF |
| Ga0181390_10913194 | 3300017719 | Seawater | VTLVYKFIDKSGIFKKTGDKLEALCYALLWGSWFLCLS |
| Ga0181420_11686911 | 3300017757 | Seawater | IKRYTRTTRTHRSIMNTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0181430_11963833 | 3300017772 | Seawater | VIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0181380_12463021 | 3300017782 | Seawater | MNTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCM |
| Ga0181424_103979011 | 3300017786 | Seawater | EMTAVALKIIDKSGIFKKVHQKAEVLCYTMLWGSWFLCLTQLF |
| Ga0181552_1000217511 | 3300017824 | Salt Marsh | MNTIKLVIDKSGIFKKVDQKVEVLCYAMLWGSMFVCMSQLAYM |
| Ga0181607_100377603 | 3300017950 | Salt Marsh | MRTVALKIIDKSGIFKKVEAKIEALCYALLWGSMFLCLAQMF |
| Ga0181600_103578821 | 3300018036 | Salt Marsh | RMRTVALKIIDKSGIFKKVEAKIEALCYALLWGSMFLCLAQMF |
| Ga0206125_100060574 | 3300020165 | Seawater | MNTIKLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0206129_100099173 | 3300020182 | Seawater | MNTVRLVVDKSGILKKIDHKVEILCYAMLWGAWFLCLAQL |
| Ga0206131_1000518821 | 3300020185 | Seawater | MNTIKVVIDKTGIFKKVDQKLEALCYAMLWGSMFLCMSQLAYM |
| Ga0181597_100345579 | 3300020194 | Salt Marsh | RTVALRIIDKSGIFKKVEAKIEALCYALLWGSMFLCLAQMF |
| Ga0211504_10027623 | 3300020347 | Marine | MNTIKLVIDKSGIFKKIDQKVEALCYALLWSSMFVCMAQIAYI |
| Ga0211504_10083011 | 3300020347 | Marine | MNTIKLVVDKSGILKKVDHKVEILCYAMLWGAWFLCLAQL |
| Ga0211504_10767751 | 3300020347 | Marine | MGSDVEMRTIALTIIDKSGIFKKVNQKAEVLCYAMLWGSWFLCLTALF |
| Ga0211554_100043555 | 3300020431 | Marine | MNTIKLVINKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0211576_1000140013 | 3300020438 | Marine | MNTIKLVIDKSGIFKKVDQKMEALCYAMLWGSMFLCMSQLAYM |
| Ga0211576_100054592 | 3300020438 | Marine | MNTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0211576_100247561 | 3300020438 | Marine | MKTIALTIIDKSGILKKVDQKVEALCYAMLWGSWFLCLTQLF |
| Ga0211576_101095183 | 3300020438 | Marine | MGSDVEMRAVALTIIDKSGIFKKVDQKLEALCYAMLWGSWFLCLTQLF |
| Ga0211577_103613363 | 3300020469 | Marine | RIEKEMKTIALTIIDKSGILKKVDQKVEALCYAMLWGSWFLCLTQLF |
| Ga0206677_1000335818 | 3300021085 | Seawater | MTAVALKIIDKSGIFKKVHQKAEVLCYTMLWGSWFLCLTQLF |
| Ga0213860_100656964 | 3300021368 | Seawater | IKLVIDKSGIFKKVDQKIETLCYAMLWGSMFVCMSQLAYM |
| Ga0213863_102311282 | 3300021371 | Seawater | MNTIKLVIDKSGIFKKVDQKIETLCYAMLWGSMFVCM |
| Ga0213869_100406862 | 3300021375 | Seawater | MGSDVEMRTIALTIIDKSGIFKKVHQKAEVLCYAMLWGSWFLCLTTLF |
| Ga0255779_12973762 | 3300022922 | Salt Marsh | MNTIKLVIDKSGIFKKVDQKVEVLCYAMLWGSMFVCMSQLAY |
| Ga0255753_13075121 | 3300022926 | Salt Marsh | TSNKRFTTLQTYRSIMNTIKLVIDKSGIFKKVDQKVEVLCYAMLWGSMFVCMSQLAYM |
| (restricted) Ga0233433_103506831 | 3300022931 | Seawater | VTLVYKFIDKSGIFKKVHEKAEVLCYTMLWGSWFLCLS |
| Ga0244775_100745734 | 3300024346 | Estuarine | MNTIKLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0244776_100209916 | 3300024348 | Estuarine | MNTIKLVIDKSGIFKKVDRKMEALCYAMLWGSMFLCMSQLAYM |
| Ga0209986_100505736 | 3300024433 | Deep Subsurface | RTHRSIMNTIKLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0209535_10204777 | 3300025120 | Marine | MNTIKLVIDKSGIFKKVDQKLEVLCYAMLWGSMFLCMSQIFTL |
| Ga0209634_10106012 | 3300025138 | Marine | MNRMSDVEMKAIAITIIDKSGIFKKVHQKAEVLCYAMLWGSWFLCLTQLL |
| Ga0209634_10161782 | 3300025138 | Marine | MKAVALTIIDKSGITKKVTEKVETLCYAMLWGSWFICLAQIF |
| Ga0209634_10724871 | 3300025138 | Marine | KLVIDKSGIFKKVDQKLEVLCYAMLWGSMFLCMSQIFTL |
| Ga0209645_100000491 | 3300025151 | Marine | MNTIKLVIDKSGIFKKVDQKIETLCYAMLWGSMFVCMSQLAYM |
| Ga0209337_13019701 | 3300025168 | Marine | MNRMSDVEMKAIAITIIDKSGIFKKVHQKAEVLCYAMLWGSWFLCLTQLF |
| Ga0208814_100263314 | 3300025276 | Deep Ocean | MNTIKLVINKSGIFKKIDQKMEALCYFMLWGLMFLCLAQVAYI |
| Ga0208814_10034533 | 3300025276 | Deep Ocean | MNTIKLVIDKSGIFKKVDQKLEALCYFMLWGSMFICMAQIAYI |
| Ga0208814_10161502 | 3300025276 | Deep Ocean | MNTIKIVIDKSGIFKKIDRKAEAFCYAMLWGSMFICIAQIAYM |
| Ga0209716_11134411 | 3300025626 | Pelagic Marine | QTYRGIMNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLAYM |
| Ga0208134_10937691 | 3300025652 | Aqueous | RYITLQTDRRIMNTIKLVINKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0208428_10559872 | 3300025653 | Aqueous | MNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQL |
| Ga0209602_10120315 | 3300025704 | Pelagic Marine | MNTIRLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLAYM |
| Ga0209714_11446242 | 3300025822 | Pelagic Marine | MNTIKLVIDKSGIFKKFEQKLEALCYTMLWGSMFLCMSQLAYM |
| Ga0208645_10931152 | 3300025853 | Aqueous | MNTIRLVIDKSGIFKKVDQKLEALCYTMLWGSMFLCMSQLAYM |
| Ga0208645_12845383 | 3300025853 | Aqueous | LVIDKSGIFKKVDQKLEALCYTMLWGSMFLCMSQLAYM |
| Ga0209309_100780561 | 3300025881 | Pelagic Marine | SIMNTIKLVIDKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0209502_1000744612 | 3300027780 | Marine | MNTIKLVIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM |
| Ga0209502_100150193 | 3300027780 | Marine | MNTIKLVVDKSGIFKKGTQKIEFLCYAMFWGAWILCLAQL |
| Ga0209711_100032651 | 3300027788 | Marine | MIRTIIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAY |
| Ga0209830_1000097922 | 3300027791 | Marine | MIRTIIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM |
| Ga0209090_100209379 | 3300027813 | Marine | MNTIKIVIDKSGIFKKVDRKMEAFCYALLWGSMFVCMAQIAYM |
| Ga0209272_102457564 | 3300027967 | Marine Sediment | NKSGIFKKVDQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0228674_10095811 | 3300028008 | Seawater | HRSIMNTIRLVIDKTGIFKKFEQKLEALCYAMLWGSMFLCMSQLFYM |
| Ga0257110_13192621 | 3300028197 | Marine | MSDVEMKAIAITIIDKSGIFKKVHQKAEVLCYAMLWGSWFLCL |
| Ga0247572_11591281 | 3300028290 | Seawater | RITTLQRDRNIMNTIKLVIDKSGIFKKIDQKVEALCYALLWSSMFVCMAQIAYI |
| Ga0307488_100644908 | 3300031519 | Sackhole Brine | MTIIAKIVDKTGIFKKLDQKAETFCYALLWSSMFICLAQMF |
| Ga0302119_1000451812 | 3300031606 | Marine | MDTIKLVIDKSGICKKVDQKVETLAYTLIWSSIIICMAQIAYI |
| Ga0302120_100554144 | 3300031701 | Marine | MDTIKLVIDKSGICKKVDQKVETLAYTLIWSSIII |
| Ga0315321_100246711 | 3300032088 | Seawater | IIDKSGIFKKVDQKLEALCYAMLWGSWFLCLTQLF |
| ⦗Top⦘ |