 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F095537 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LLQVELLHKGGLAGGGPAAHADGVLKSVLEYVDQFSTRIRDANK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.95 % |
| % of genes from short scaffolds (< 2000 bps) | 0.95 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 4.76 |
| PF02566 | OsmC | 2.86 |
| PF13442 | Cytochrome_CBB3 | 1.90 |
| PF04519 | Bactofilin | 1.90 |
| PF14534 | DUF4440 | 1.90 |
| PF07995 | GSDH | 1.90 |
| PF05163 | DinB | 1.90 |
| PF08309 | LVIVD | 1.90 |
| PF02371 | Transposase_20 | 1.90 |
| PF13699 | DUF4157 | 1.90 |
| PF07635 | PSCyt1 | 1.90 |
| PF13432 | TPR_16 | 1.90 |
| PF12833 | HTH_18 | 0.95 |
| PF12867 | DinB_2 | 0.95 |
| PF07637 | PSD5 | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF12681 | Glyoxalase_2 | 0.95 |
| PF05336 | rhaM | 0.95 |
| PF02887 | PK_C | 0.95 |
| PF13304 | AAA_21 | 0.95 |
| PF07969 | Amidohydro_3 | 0.95 |
| PF01186 | Lysyl_oxidase | 0.95 |
| PF13714 | PEP_mutase | 0.95 |
| PF14849 | YidC_periplas | 0.95 |
| PF01453 | B_lectin | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF01966 | HD | 0.95 |
| PF00903 | Glyoxalase | 0.95 |
| PF13278 | Obsolete Pfam Family | 0.95 |
| PF13474 | SnoaL_3 | 0.95 |
| PF01436 | NHL | 0.95 |
| PF00582 | Usp | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.86 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.86 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.90 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.90 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.90 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.90 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.90 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.95 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300033487|Ga0316630_11379816 | Not Available | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_109416252 | 3300000363 | Soil | GGLAGGAPAAHAEGVLKSVLEYVDQFSTRIRDANK* |
| ICChiseqgaiiFebDRAFT_134549851 | 3300000363 | Soil | AQLTHTVSPVLLQVELLHKGGLAGGAPAAHADDVLKNVLEYVGQFSTRIRDANK* |
| JGI11643J12802_104400101 | 3300000890 | Soil | SSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK* |
| JGI10216J12902_1105378721 | 3300000956 | Soil | AAPLAHTSAPVELQVELLRKGGLAGGAPAQNGDAVTKNVLEYVDQFAARIKNANK* |
| JGI24743J22301_100618331 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | YQDKPVLVQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK* |
| JGI24035J26624_10246242 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK* |
| JGI24036J26619_100300531 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | VQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK* |
| Ga0065715_106888841 | 3300005293 | Miscanthus Rhizosphere | VLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK* |
| Ga0065707_102437672 | 3300005295 | Switchgrass Rhizosphere | VLVQVSLLHKGGIAGGAPTPHAEGVLRGVQESVDQFSTRIRDANK* |
| Ga0070690_1002148442 | 3300005330 | Switchgrass Rhizosphere | LQVELLHKGGLAGGGPAQNGDTVTKNVLEYVDQVTTRIKNANK* |
| Ga0070690_1002646611 | 3300005330 | Switchgrass Rhizosphere | PVLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK* |
| Ga0068869_1017246391 | 3300005334 | Miscanthus Rhizosphere | ELLHKGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK* |
| Ga0070687_1000853411 | 3300005343 | Switchgrass Rhizosphere | PLAHTAAPVELQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK* |
| Ga0070671_1008730091 | 3300005355 | Switchgrass Rhizosphere | LQVELLHKGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK* |
| Ga0070708_1013379451 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SYQETPVLVQVSLLHKGGIAGGASATHAEGVLRGVQEYVDQFSTRIRDVNK* |
| Ga0070698_1010894922 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLVQVSLLHKGGIAGGASSVHAEGVLRGVQEFVDQFSTRIRDANK* |
| Ga0070697_1020657702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TAKLSYQETPVLVQVSLLHKGGIAGGASATHAAGVLRGVQEYVDQFSTRIRDANK* |
| Ga0070665_1011336011 | 3300005548 | Switchgrass Rhizosphere | LHKGGIAGGASAANADGVTRGLLDYIDGFATRIKDANKPH* |
| Ga0070704_1016574631 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ETPVLVQVSLLHKGGIGGGSPAAHAAEVLRSVQEYVGQFATRIRDANK* |
| Ga0066698_109993031 | 3300005558 | Soil | YQDTPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK* |
| Ga0070664_1017523172 | 3300005564 | Corn Rhizosphere | GGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK* |
| Ga0068857_1023945531 | 3300005577 | Corn Rhizosphere | VLVEVSLLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ* |
| Ga0068859_1001201762 | 3300005617 | Switchgrass Rhizosphere | KLPHTESPVLLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK* |
| Ga0068870_114247251 | 3300005840 | Miscanthus Rhizosphere | ELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIHNAGK* |
| Ga0068863_1017482581 | 3300005841 | Switchgrass Rhizosphere | LQVELLHKGGLAGGAPAQNGDTVTKNVLDYVDQFAARIKNANK* |
| Ga0075294_10337812 | 3300005881 | Rice Paddy Soil | VLLQVELLHRGGIAGGAPAAHADGVTKSLLEYVDQFSNRIRNAGK* |
| Ga0066656_104916462 | 3300006034 | Soil | AGGAAAAHAEAVLRGVQEYIDQFSTRIRDANKKL* |
| Ga0068871_1021575191 | 3300006358 | Miscanthus Rhizosphere | LLVQVSLLHKGGIAGGAPASHAEGVLRGVKQYVDQFATRIRDANK* |
| Ga0079222_119299541 | 3300006755 | Agricultural Soil | LLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ* |
| Ga0066665_108927371 | 3300006796 | Soil | LLHKGGIAGGAPAAHADGVVKSVLEYVDQFSARIRNAAK* |
| Ga0079220_111318341 | 3300006806 | Agricultural Soil | LHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ* |
| Ga0111539_117802142 | 3300009094 | Populus Rhizosphere | SAPVELQVELLHKGGLAGGAPAQNGDAVTKNVLEYVDQFATRIKNANK* |
| Ga0066709_1008231372 | 3300009137 | Grasslands Soil | LLHKGGLAGGAAAAHAGSVLRGVQEYVDQFSTRIRDANKKL* |
| Ga0066709_1028665111 | 3300009137 | Grasslands Soil | VLVLVSLLHKGGLAGGAPAAHAEGVLRGVQEYVDQFSTRIRDANK* |
| Ga0105243_114992912 | 3300009148 | Miscanthus Rhizosphere | LLHKGGIAGGAPASHAESVLRGVKQYVDQFATRIRDANK* |
| Ga0111538_116599033 | 3300009156 | Populus Rhizosphere | VAPLGHTASAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK* |
| Ga0134127_114654642 | 3300010399 | Terrestrial Soil | SPVLLQVELLHKGGLAGGAPAAHAEGVLKSVLEYVDQFSTRIRDANK* |
| Ga0105246_121283682 | 3300011119 | Miscanthus Rhizosphere | SSPVELQVELIHKGGLAGGSPAVHADAVTKNVLELVDQFATRVRDANK* |
| Ga0137393_112058172 | 3300011271 | Vadose Zone Soil | KLAYQEAPVLVQVSLLHKGGLAGGASAVHAEAVLRGVQEYVDQFSARVRDANK* |
| Ga0137365_100776571 | 3300012201 | Vadose Zone Soil | DTPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK* |
| Ga0137376_108363212 | 3300012208 | Vadose Zone Soil | LSHTASPVLLQVELLHKGGIAGGAPAAHADGVVKSVLEYVDQFSARIRNAAK* |
| Ga0137371_105394742 | 3300012356 | Vadose Zone Soil | HMGGIAGVASAAHAAGVLRGVQEYVDQFSTRIRDANK* |
| Ga0157355_10459141 | 3300012493 | Unplanted Soil | PHTSSPVLLQAELLHRGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK* |
| Ga0157284_100331241 | 3300012893 | Soil | VVSAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK* |
| Ga0157296_100178053 | 3300012905 | Soil | SAVELQVELLHRGGLAGGGPAAHADSVVKNVLDYVGQFAARVREANK* |
| Ga0137359_115050142 | 3300012923 | Vadose Zone Soil | PVLVQVSLLHKGGIAGSASASHAEAVLRGVQEYVDQFSTRIRNANK* |
| Ga0137410_114875301 | 3300012944 | Vadose Zone Soil | VSLLHGGGLGGGAPAAHAESVLRGVQEYVDQFATRVRDANK* |
| Ga0126375_111355612 | 3300012948 | Tropical Forest Soil | SYQESPVLVQVSLLHKGGIAGGAAASHGAAVLRGLQEYVEQFSTRIHDANK* |
| Ga0164301_103324962 | 3300012960 | Soil | VELLHKGGLGGGSPAQHADAVTKSVLEYVDQFATRVKNANQ* |
| Ga0134077_103404422 | 3300012972 | Grasslands Soil | LHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK* |
| Ga0134087_104172341 | 3300012977 | Grasslands Soil | QVSLLHKGSVAGGPPANHATAVLRGLQDYVDQFCSRIQAANK* |
| Ga0157371_105728342 | 3300013102 | Corn Rhizosphere | AAKLPHTSSPVLLQAELLHKGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK* |
| Ga0157378_104276272 | 3300013297 | Miscanthus Rhizosphere | VELQVELLHKGGLAGGAPAQNGASVTKSVLEYVDQFTTRIKNANK* |
| Ga0120111_10876251 | 3300013764 | Permafrost | LSYQETPVLVQVSLLHKGGIAGGAPAAHAEGVLRGVQEYVDQFSTRIRDANK* |
| Ga0157380_131595821 | 3300014326 | Switchgrass Rhizosphere | ESPVLVQAELLHKGGIAGGAPDAHATGVTKGIIEYVDQFSTRIRNAGK* |
| Ga0157377_101692831 | 3300014745 | Miscanthus Rhizosphere | HKGGLTGGGPGVHADGVLKSVLEYVDQFSTRVRDANK* |
| Ga0157376_110584441 | 3300014969 | Miscanthus Rhizosphere | GGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK* |
| Ga0173483_100473353 | 3300015077 | Soil | AQLTHTAATVLVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK* |
| Ga0132256_1024306222 | 3300015372 | Arabidopsis Rhizosphere | ARLTHTASPVLLQVELLHKGGLAGGGPAVHPDSMLKSVLEYVDQFSTRIRNANK* |
| Ga0132256_1037188611 | 3300015372 | Arabidopsis Rhizosphere | LPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK* |
| Ga0132257_1008379272 | 3300015373 | Arabidopsis Rhizosphere | LQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK* |
| Ga0132255_1052542521 | 3300015374 | Arabidopsis Rhizosphere | SAAKLPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK* |
| Ga0187788_104619551 | 3300018032 | Tropical Peatland | VLVQVSLLHRGGLAGGSGAAHAESVLRGLQEYVDLFTTQIRTANSQK |
| Ga0184620_100966311 | 3300018051 | Groundwater Sediment | LLHKGGIAGGAPAAHADGVLRGVQEYVDQFATQIRNANK |
| Ga0184611_10124503 | 3300018067 | Groundwater Sediment | LVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK |
| Ga0190271_119455641 | 3300018481 | Soil | LLQVELLHKGGLAGGGPAAHADGVLKNVLEYVDQFTTRIRSANN |
| Ga0210384_112253463 | 3300021432 | Soil | LHRGGIAGGASAAHAEGVLRGVQEYVDQFSTRIREANK |
| Ga0207697_101556631 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | HKGGLTGGGPGVHADGVLKSVLEYVDQFSTRVRDANK |
| Ga0207662_101988292 | 3300025918 | Switchgrass Rhizosphere | PLAHTAAPVELQVELLHKGGLAGGAPAQNGDSVTKSVLEYVDQFTTRIKNANK |
| Ga0207690_112380192 | 3300025932 | Corn Rhizosphere | LSYQDKPVLVQVQLLHKGGLTGGAPAAHGDGVVKGVLDYVDQFVTRIRDANK |
| Ga0207704_108324611 | 3300025938 | Miscanthus Rhizosphere | LLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSLRIRNAGK |
| Ga0207711_103318831 | 3300025941 | Switchgrass Rhizosphere | LLVQVSLLHKGGIAGGAPASHAEGVLRGVKQYVDQFATRIRDANK |
| Ga0207711_113672152 | 3300025941 | Switchgrass Rhizosphere | VELQVELIHKGGLAGGSPAVHADAVTKNVLELVDQFATRVRDANK |
| Ga0207703_111784061 | 3300026035 | Switchgrass Rhizosphere | LLHKGGIAGGAPTPHAEGVLRGVQESVDQFSTRIRDANR |
| Ga0207639_105227701 | 3300026041 | Corn Rhizosphere | AKLPHTSSPVLLQAELLHKGGLAGGSPAAHADGVLKSVLEYLDQFTTRIREANK |
| Ga0207678_105783142 | 3300026067 | Corn Rhizosphere | LVEVSLLHKGGIAGGTPAVHADGVVRGLLDYIDGFVTRIREANKAQ |
| Ga0207641_105883342 | 3300026088 | Switchgrass Rhizosphere | VLLQVELLHKGGIAGGAPGAHADGVTKSLLEYVDQFSNRIRNAGK |
| Ga0207675_1017495322 | 3300026118 | Switchgrass Rhizosphere | LLHKGGLAGGASATHADAVLRGVQEYVDQFATRIHDANK |
| Ga0209468_10973782 | 3300026306 | Soil | SLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK |
| Ga0209058_13153021 | 3300026536 | Soil | TPVLVQVSLLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIRDANK |
| Ga0209998_100386581 | 3300027717 | Arabidopsis Thaliana Rhizosphere | SAAKLPHTSSPVLLQAELLHKGGLAGGGPAVHADGVLKSVLEYLDQFTTRIREANK |
| Ga0209701_107140481 | 3300027862 | Vadose Zone Soil | LLHKGGIAGGASAAHAAGVLRGVQEYVDQFSTRIHDANK |
| Ga0307285_100746271 | 3300028712 | Soil | VQLLRKGGLTGGAPAVHGAGVVKGVEDYLDQFITRIAAANK |
| Ga0307309_101465002 | 3300028714 | Soil | TTAKLSYQETPVLVQVSLLHKGGIGGGTPAAHAAEVLRNVQEYVDQFATRIRDANK |
| Ga0307282_105899181 | 3300028784 | Soil | QVSLLHKGGIAGGAAAAHAEGVLRGVQEYVDQFTGRIRDANKP |
| Ga0307312_106496941 | 3300028828 | Soil | YQKTPVLVQVSLLHKGGIAGGAAAAHAEAVLRGVQEYVDQFSTRIREANK |
| Ga0307499_102155002 | 3300031184 | Soil | LLQVELLHKGGLAGGGPAAHADGVLKSVLEYVDQFSTRIRDANK |
| Ga0310888_103641842 | 3300031538 | Soil | QLTHTAATVLVQVELLHKGGLTGGAPGVHADGVLKSVLEYVDQFSTRVRDANK |
| Ga0310915_105534162 | 3300031573 | Soil | QDTPVLVQVSLLHRGGLAGGSPAPHADGVIRGLQEYVDQFSARIRAANN |
| Ga0310813_101356611 | 3300031716 | Soil | LLQAELLHKGGLAGAGPAAHADGVLKNVLEYVDQFSTRIRDANK |
| Ga0310813_105994761 | 3300031716 | Soil | VELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIRNAGK |
| Ga0307473_107873982 | 3300031820 | Hardwood Forest Soil | HKGGIAGGTSASHAEAVLRGVQEYVDQFSTRIRNANK |
| Ga0310904_104341562 | 3300031854 | Soil | HTTAPVLLQVELLHKGGLAGGGPGVHADGVLKSVLEYVDQLSTRVRDANK |
| Ga0310904_111233411 | 3300031854 | Soil | TVLLQVELLHKGGLTGGGPGVHADGVMKSVLEYLDQFSTRVRDANK |
| Ga0310893_105550811 | 3300031892 | Soil | ELLHKGGLAGGGPAVHADGVLKSVLEYVDQFATRIRDANK |
| Ga0310900_101114101 | 3300031908 | Soil | LHKGGLAGGGAAVHADGLLKNVLEYVDQFSTRIRNANN |
| Ga0310900_102783101 | 3300031908 | Soil | AAPLAHTSAPVLLQVELLHKGGLAGGSPAQHADAVTQSVLEYVDQFATRVKNANQ |
| Ga0306921_103405631 | 3300031912 | Soil | AKLSYQDTPVLVQVSLLHRGGLAGGSPAPHADGVIRGLQEYVDQFSARIRAANN |
| Ga0306921_107538603 | 3300031912 | Soil | VSLLHKGGIAGGPSTQHGDAVLRGVQEYIDQFLTRIRDANK |
| Ga0306926_113178183 | 3300031954 | Soil | KLSYQTTPALVQVSLLHKGGIAGGPSTQHGDAVLRGVQEYIDQFLTRIRDANK |
| Ga0310897_102666852 | 3300032003 | Soil | HTTAPVLLQVELLHKGGLAGGGPGVHADGVLKSVLEYVDQFSTRVRDANK |
| Ga0310906_112514371 | 3300032013 | Soil | HTESPVLLQVELLHKGGIAGGAPDAHANGVTKSLIEFVDQFSTRIRNAGK |
| Ga0316624_116516162 | 3300033486 | Soil | DTPVLVQVSLMHKGGLAGGAPAAHAEGVLRGVKQYVDQVAARIRDANK |
| Ga0316630_113798162 | 3300033487 | Soil | AAAKLTHTASPVLVQVELLHKGGLAGAGPAVHGDGVLKSVLEYVDQFATRVSAANR |
| Ga0364927_0028349_1216_1374 | 3300034148 | Sediment | LTHTASTVLLQVELLHKGGLAGGGPAVHADGVLKNVLEYVDQFSTRIRDANR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |