| Basic Information | |
|---|---|
| Family ID | F095530 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSTCDITSGFTLGCRDNTGGIANIYILSGSIDSVTDASEGLIQTI |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 24.10 % |
| % of genes near scaffold ends (potentially truncated) | 78.10 % |
| % of genes from short scaffolds (< 2000 bps) | 69.52 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (65.714 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (31.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.905 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (64.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 7.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.05 % |
| Unclassified | root | N/A | 20.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10021481 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3050 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10200414 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 640 | Open in IMG/M |
| 3300000949|BBAY94_10008056 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2911 | Open in IMG/M |
| 3300001183|BBAY88_1040047 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 880 | Open in IMG/M |
| 3300004096|Ga0066177_10468084 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 554 | Open in IMG/M |
| 3300004642|Ga0066612_1300170 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 725 | Open in IMG/M |
| 3300004836|Ga0007759_11512197 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 749 | Open in IMG/M |
| 3300005611|Ga0074647_1047828 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 502 | Open in IMG/M |
| 3300006405|Ga0075510_10964553 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1219 | Open in IMG/M |
| 3300006802|Ga0070749_10073390 | All Organisms → Viruses → Predicted Viral | 2050 | Open in IMG/M |
| 3300006802|Ga0070749_10234663 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1043 | Open in IMG/M |
| 3300007236|Ga0075463_10087214 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1007 | Open in IMG/M |
| 3300007346|Ga0070753_1059419 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1551 | Open in IMG/M |
| 3300007346|Ga0070753_1088788 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1218 | Open in IMG/M |
| 3300007346|Ga0070753_1209758 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 718 | Open in IMG/M |
| 3300007538|Ga0099851_1102819 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300007538|Ga0099851_1258622 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 621 | Open in IMG/M |
| 3300009001|Ga0102963_1331218 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 598 | Open in IMG/M |
| 3300009124|Ga0118687_10181993 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 761 | Open in IMG/M |
| 3300009433|Ga0115545_1079341 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1213 | Open in IMG/M |
| 3300010392|Ga0118731_108516693 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 717 | Open in IMG/M |
| 3300011118|Ga0114922_11160596 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 625 | Open in IMG/M |
| 3300012522|Ga0129326_1448450 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 660 | Open in IMG/M |
| 3300012524|Ga0129331_1488433 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1826 | Open in IMG/M |
| 3300012666|Ga0157498_1052759 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 623 | Open in IMG/M |
| 3300012963|Ga0129340_1107464 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 583 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10191533 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1298 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10085053 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2034 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10516219 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 689 | Open in IMG/M |
| 3300014042|Ga0117790_1070718 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 558 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10267045 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1040 | Open in IMG/M |
| 3300016723|Ga0182085_1074604 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300016726|Ga0182045_1407631 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 578 | Open in IMG/M |
| 3300016731|Ga0182094_1337617 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300016732|Ga0182057_1428181 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300017713|Ga0181391_1075628 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 772 | Open in IMG/M |
| 3300017722|Ga0181347_1100299 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 826 | Open in IMG/M |
| 3300017728|Ga0181419_1081605 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 808 | Open in IMG/M |
| 3300017742|Ga0181399_1028847 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1514 | Open in IMG/M |
| 3300017780|Ga0181346_1261932 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 600 | Open in IMG/M |
| 3300017950|Ga0181607_10072874 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
| 3300019281|Ga0182077_1624603 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 553 | Open in IMG/M |
| 3300019283|Ga0182058_1220691 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 708 | Open in IMG/M |
| 3300019459|Ga0181562_10525914 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 559 | Open in IMG/M |
| 3300019784|Ga0181359_1136217 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 860 | Open in IMG/M |
| 3300020014|Ga0182044_1440942 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 546 | Open in IMG/M |
| 3300020185|Ga0206131_10028979 | All Organisms → Viruses → Predicted Viral | 4241 | Open in IMG/M |
| 3300020185|Ga0206131_10152131 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1211 | Open in IMG/M |
| 3300020185|Ga0206131_10187919 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300020191|Ga0181604_10423516 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 567 | Open in IMG/M |
| 3300020810|Ga0181598_1318791 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 546 | Open in IMG/M |
| 3300021093|Ga0194123_10280258 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 806 | Open in IMG/M |
| 3300021958|Ga0222718_10320886 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 798 | Open in IMG/M |
| 3300021961|Ga0222714_10574297 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 567 | Open in IMG/M |
| 3300021962|Ga0222713_10274075 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1088 | Open in IMG/M |
| 3300022065|Ga0212024_1014847 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300022065|Ga0212024_1022887 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300022068|Ga0212021_1095055 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 612 | Open in IMG/M |
| 3300022158|Ga0196897_1031765 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 636 | Open in IMG/M |
| 3300022168|Ga0212027_1011757 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1204 | Open in IMG/M |
| 3300022821|Ga0222673_1008762 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1858 | Open in IMG/M |
| 3300023179|Ga0214923_10308274 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 857 | Open in IMG/M |
| 3300025108|Ga0208793_1086199 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 898 | Open in IMG/M |
| 3300025695|Ga0209653_1197759 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 551 | Open in IMG/M |
| 3300025767|Ga0209137_1165344 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 785 | Open in IMG/M |
| 3300025769|Ga0208767_1110605 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300025853|Ga0208645_1055054 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1870 | Open in IMG/M |
| 3300025853|Ga0208645_1212824 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 674 | Open in IMG/M |
| 3300026187|Ga0209929_1054281 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300026187|Ga0209929_1135649 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 611 | Open in IMG/M |
| 3300026461|Ga0247600_1108892 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 550 | Open in IMG/M |
| 3300027917|Ga0209536_102915913 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 554 | Open in IMG/M |
| 3300028125|Ga0256368_1073533 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 585 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1050369 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2410 | Open in IMG/M |
| 3300029302|Ga0135227_1034414 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 576 | Open in IMG/M |
| 3300031539|Ga0307380_10101640 | All Organisms → Viruses → Predicted Viral | 2962 | Open in IMG/M |
| 3300031565|Ga0307379_10379845 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1362 | Open in IMG/M |
| 3300031578|Ga0307376_10028724 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4241 | Open in IMG/M |
| 3300031669|Ga0307375_10281691 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1074 | Open in IMG/M |
| 3300031673|Ga0307377_10149097 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1853 | Open in IMG/M |
| 3300031673|Ga0307377_10151355 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1837 | Open in IMG/M |
| 3300034071|Ga0335028_0638097 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 567 | Open in IMG/M |
| 3300034101|Ga0335027_0040352 | All Organisms → Viruses → Predicted Viral | 3839 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 31.43% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 6.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.76% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.86% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.90% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.90% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.95% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.95% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.95% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.95% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.95% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.95% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.95% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.95% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.95% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.95% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.95% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.95% |
| Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001183 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY88 | Host-Associated | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300006373 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300016723 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016731 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022140 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v3) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026461 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100214811 | 3300000115 | Marine | MACDISSGFSLACRDNSGGIKNIYILSGSVSTVTEASEGLIS |
| DelMOSpr2010_102004141 | 3300000116 | Marine | MSTCDITSGFTLGCRDNTGGIRNIYILSGSVDSVTGSGATGL |
| BBAY94_100080561 | 3300000949 | Macroalgal Surface | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDTITDASEGLIN |
| BBAY88_10400472 | 3300001183 | Macroalgal Surface | MACDISSGFSLACRDNSGGIKNIYILSGSTPVISESSEGLISDL |
| RCM30_10538811 | 3300001842 | Marine Plankton | MACSITAGFQLGCRNNTGGIKNIYILSGSISSISGSQGL |
| Ga0066177_104680841 | 3300004096 | Freshwater Lake | MACEISSGFTLGCRDNTGGIKNIYILSGSITATNGTEGLITSI |
| Ga0066612_13001702 | 3300004642 | Marine | MSTCDITSGFTLGCRDNTGGIKNLYILSGSISSVADASEGLINGITGSG |
| Ga0007759_115121972 | 3300004836 | Freshwater Lake | MPCAITSGFQLGCRDNTGGIKNIYILSGSISNITGSQGLITSIS |
| Ga0074647_10478281 | 3300005611 | Saline Water And Sediment | MATCDITSGFTLGCRDNTGGIRKLYILSGSISSVSGSTGYIESI |
| Ga0075483_12708072 | 3300006373 | Aqueous | MSCQITSGRSIPCRQSLGGIKNIYILSGSVAGTTAA |
| Ga0075510_109645531 | 3300006405 | Aqueous | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDTIVDASEGLISEMTGS |
| Ga0075486_10081382 | 3300006425 | Aqueous | MSCQITSGRSIPCRQSLGGIKNIYILSGSVAGVTAASG |
| Ga0070749_100733904 | 3300006802 | Aqueous | MSTCDITSGFTLGCRDNTGGIANIYILSGSIDSVTD |
| Ga0070749_101638413 | 3300006802 | Aqueous | MSCQITSGRSILCRQSLGGIKNIYILSGSVAGVTAASGAIS |
| Ga0070749_102346631 | 3300006802 | Aqueous | MSTCDITSGFTLGCRDNTGGIANIYILSGSIDSVTDASEGLIQTI |
| Ga0070754_102366952 | 3300006810 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSITSVAD |
| Ga0070754_104133722 | 3300006810 | Aqueous | MSTCDITSGFTLGCRDNTGGIKNVYILSGSVDSVTGS |
| Ga0075463_100872142 | 3300007236 | Aqueous | MSSCDITSGFTLGCRDNTGGLKNIYILSGSISSTSGTTGLLSAV |
| Ga0070745_11431441 | 3300007344 | Aqueous | MSTCDITSGFTLGCRDNTGGIRNLYILSGSVAGLTG |
| Ga0070753_10594193 | 3300007346 | Aqueous | MACDITSGFTLGCRDNSGGIKNIYILSGSVAGITEASEGLISDISG |
| Ga0070753_10887881 | 3300007346 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSITTVAD |
| Ga0070753_12097581 | 3300007346 | Aqueous | SGFTLGCRDNSGGIKNIYILSGSVAGITEASEGLISDISG* |
| Ga0099851_11028191 | 3300007538 | Aqueous | MSTCDITSGFTLGCRDNTGGLKNIYILSGSISSTSGTTGLLSQISGSG |
| Ga0099851_12586221 | 3300007538 | Aqueous | MATCDITSGFTLGCRDNSGGIKNIYILSGSITSIDEVSDGLISAISGSGTFF |
| Ga0099846_12412442 | 3300007542 | Aqueous | MACDITSGFTLGCRDNVGSIKQIYILSGSVTSVVDASEGLI |
| Ga0099846_12849761 | 3300007542 | Aqueous | MSSCDITSGFTLGCRDNTGGLKNIYILSGSISSTS |
| Ga0102963_13312181 | 3300009001 | Pond Water | MSTCDITSGFTLGCRDNSGGIKNLYILSGSITSVGDASEGLINSISGSG |
| Ga0118687_101819932 | 3300009124 | Sediment | MSCDITSGFTLGCRDNTGGLKNIYILSGSISSTGGATGLLDAISG |
| Ga0115545_10793413 | 3300009433 | Pelagic Marine | MSTYDITSGFTLGCRDNTGGIANLYILSGSITSVTDA |
| Ga0118731_1085166932 | 3300010392 | Marine | MACDITSGFTLGCRDNSGGIKNVYILSGSISTVNEVSDGLISGIT |
| Ga0114922_111605961 | 3300011118 | Deep Subsurface | MSCDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGL |
| Ga0129326_14484501 | 3300012522 | Aqueous | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDSVTGSGDVGLITAISGS |
| Ga0129331_14884331 | 3300012524 | Aqueous | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDSVTGSGDVGLITAISGSGTF |
| Ga0157498_10527591 | 3300012666 | Freshwater, Surface Ice | MPTPCQITSGFTLGCRDNVGSIKNIYILSGSITAVN |
| Ga0129340_11074642 | 3300012963 | Aqueous | MATCDITSGFTLGCRDNTGGLKNIYILSGSVDSVTGSGATGLITAIS |
| (restricted) Ga0172367_101915331 | 3300013126 | Freshwater | MSCDITSGFQLGCRDNTGGLKAIYILSGSITSISGSQGLITAISGSG |
| (restricted) Ga0172365_100850534 | 3300013127 | Sediment | MACSITSGFQLGCRDNTGGIKNIYILSGSISSISGSQGLITAISGS |
| (restricted) Ga0172365_105162192 | 3300013127 | Sediment | MSCDITSGFQLGCRDNTGGLKALYILSGSITTINTAADGT |
| Ga0117790_10707182 | 3300014042 | Epidermal Mucus | MACDITSGFQLGCRDNTGGLKAIYILSGSIETIDGTQGLIT |
| (restricted) Ga0172376_102670451 | 3300014720 | Freshwater | MPAPCQITSGYTLGCRDNIGSIKNIFILSGSVTAVVAPTEGLITQ |
| Ga0182085_10746042 | 3300016723 | Salt Marsh | MSTCDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGLLNELSGSGTF |
| Ga0182085_11439471 | 3300016723 | Salt Marsh | MACDVTAGFQLGCRDNSGGIKSVYILSGSVTTVTESSGEITDISG |
| Ga0182045_14076311 | 3300016726 | Salt Marsh | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDSVVGS |
| Ga0182094_13376171 | 3300016731 | Salt Marsh | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDTITDASEGLINAISGSGTF |
| Ga0182057_14281813 | 3300016732 | Salt Marsh | MSTCDITSGFSLGCRDNSGGIKNLFILSGSISAVADESEGLINSISGS |
| Ga0182092_10740322 | 3300016734 | Salt Marsh | MACDVTAGFQLGCRDNSGGIKSVYILSGSITTITESSDEITDI |
| Ga0182095_11699831 | 3300016791 | Salt Marsh | MSTCDISSGFTLGCRDNSGGIKNIYILSGSIDTITDAS |
| Ga0181391_10756281 | 3300017713 | Seawater | MACDITSGFQLGCRDNMGGLRQIYILSGSVVSVTGATNGLITDISG |
| Ga0181347_11002992 | 3300017722 | Freshwater Lake | MPCAITSGFQLGCRDNTGGIKNIYILSGSISSISGSQGL |
| Ga0181419_10816052 | 3300017728 | Seawater | MACDITSGFQLGCRDNSGGISNIYILSGSVTSVTEASGEITDLSGDGV |
| Ga0181399_10288471 | 3300017742 | Seawater | MACDITSGFTLGCRDNSGGIKNIYILSGSIDTVTGYENGYITD |
| Ga0181346_12619322 | 3300017780 | Freshwater Lake | MPCAITSGFQLGCRDNTGGIKNIYILSGSISSISGSQGLI |
| Ga0181607_100728744 | 3300017950 | Salt Marsh | MSTCDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGLL |
| Ga0181564_107260952 | 3300018876 | Salt Marsh | MACDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGT |
| Ga0182077_16246032 | 3300019281 | Salt Marsh | MACEITSGFTLECRDNAGGIKNIYILSGSIAGTTGETNGLLTDISG |
| Ga0182058_12206911 | 3300019283 | Salt Marsh | MSTCDITSGFSLGCRDNSGGIKNLFILSGSISAVADESEG |
| Ga0181562_105259141 | 3300019459 | Salt Marsh | MACDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGLID |
| Ga0181359_11362172 | 3300019784 | Freshwater Lake | MPCAITSGFQLGCRDNTGGIKNIYILSGSISSISGSQGLITSISG |
| Ga0182044_14409421 | 3300020014 | Salt Marsh | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDTVTDESTGLIGALSGSGT |
| Ga0206131_100289791 | 3300020185 | Seawater | MSCDITSGFTLGCRDNTGGIANLYILSGSIDSVVDASEGLIET |
| Ga0206131_101521313 | 3300020185 | Seawater | MSTCDITSGFTLGCRDNTGGIANLYILSGSIDSVVDASEGLIET |
| Ga0206131_101879191 | 3300020185 | Seawater | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDTIVDASEG |
| Ga0181604_104235162 | 3300020191 | Salt Marsh | MSTCDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGLLN |
| Ga0181598_13187912 | 3300020810 | Salt Marsh | MSTCDITSGFTLGCRDNTGGLKNIYILSGSIDSTSGTTGL |
| Ga0194123_102802581 | 3300021093 | Freshwater Lake | MSCDITSGFTLGCRDNVGSIKQIYILSGSVTNVVDASEGLINAITGSG |
| Ga0222718_103208862 | 3300021958 | Estuarine Water | MATCDITSGFTLGCRDNTGGIRKLYILSGSISSVSGSTGYIESISGSGD |
| Ga0222714_105742971 | 3300021961 | Estuarine Water | MSTCDITSGFTLGCRDNSGGIKNIYILSGSITTISEVSDGLIGGI |
| Ga0222713_102740751 | 3300021962 | Estuarine Water | MACDITSGLTLGCRDNVGSIKQIYILSGSVSNVTDASEGLINSITGSGVF |
| Ga0196883_10340421 | 3300022050 | Aqueous | MSTCDITSGFTLGCRDNTGGIANIYILSGSIDSVTDASEK |
| Ga0212024_10148473 | 3300022065 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSITSVTDASEGLSFFFSFP |
| Ga0212024_10228872 | 3300022065 | Aqueous | MSTCDITSGFTLGCRDNTGGIRNIYILSGSVDSVTGSGASYP |
| Ga0212021_10950551 | 3300022068 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSITSVVDASEGL |
| Ga0196885_1038192 | 3300022140 | Aqueous | MSCQITSGRSIPCRQSLGGIKNIYILSGSVAGTTAASGAISDISGSK |
| Ga0196897_10317651 | 3300022158 | Aqueous | MSTCDIASGFTLGCRDNTGGLKNIYILSGSISSTSGTTGLLSQVSSSG |
| Ga0212027_10117571 | 3300022168 | Aqueous | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDSVTGSGTTGLISAMSG |
| Ga0224504_102538932 | 3300022308 | Sediment | MACDISSGFQLGCRDNSGGIQNVYILSGSVTSVTDSSGEISTIS |
| Ga0222673_10087624 | 3300022821 | Saline Water | MSCNITKGFELGCRDNTGGIKRAYILGGSITSVTVADVATAPF |
| Ga0214923_103082741 | 3300023179 | Freshwater | MPSPCQITSGTTLGCRDNVGSIKNIWILSGSITNIVETSEGLITQITGSAGSQFWK |
| Ga0208793_10861991 | 3300025108 | Marine | MSCDITSGFELGCRDNSGGIKNLYILGASGSVAGTIESVTDASE |
| Ga0208303_10815021 | 3300025543 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSIDSVTDA |
| Ga0208643_11299411 | 3300025645 | Aqueous | MSTCDIIAGFTLGCRDNVGGITNLYILSGSITTVN |
| Ga0209653_11977592 | 3300025695 | Marine | MACDITSGFELGCRDNAGGIKNLYILSGSIDTITGADSGLISDV |
| Ga0209137_11653441 | 3300025767 | Marine | MSCDITSGFTLGCRDNTGGLKNIYILSGSVDSTSGTTGLL |
| Ga0208767_11106052 | 3300025769 | Aqueous | MSTCDITSGFTLGCRDNTGGIKNLYILSGSIDTVTDASEGVISGITGSGG |
| Ga0208767_11490482 | 3300025769 | Aqueous | MSCQITSGRSIPCRQSLGGIKNIYILSGSVAGVTAASGAIS |
| Ga0208645_10550541 | 3300025853 | Aqueous | MSTCDITSGFTLGCRDNTGGIANLYILSGSITSVADASEGLISGITGSGEF |
| Ga0208645_12128242 | 3300025853 | Aqueous | MACDITSGFTLGCRDNSGGIKNIYILSGSIAGITEASEGLISDISGSG |
| Ga0209929_10542812 | 3300026187 | Pond Water | MSTCDITSGFTLGCRDNTGGIKNIYILSGSVDSVTGSGADGLI |
| Ga0209929_11356492 | 3300026187 | Pond Water | MATCDITSGFTLGCRDNTGGITNLYILSGSIDTVTTASEGLIDAI |
| Ga0247600_11088921 | 3300026461 | Seawater | MSTCDITSGFSLGCRDNTGGIANLYILSGSIDSVVDASEGLIETISG |
| Ga0209536_1029159131 | 3300027917 | Marine Sediment | MSTCDITSGFTLGCRDNTGGIKNVYILSGSVDTVTGSGSTGLISAISGS |
| Ga0256368_10735331 | 3300028125 | Sea-Ice Brine | MSTCDITSGFTLGCRDNVGGITNLYILSGSITTVTDVSDG |
| Ga0228648_10880192 | 3300028126 | Seawater | MACNISSGFTLACRDNSGGIKNIYILSGSVSSVVEASEGL |
| (restricted) Ga0247844_10503691 | 3300028571 | Freshwater | MSCQITSGFTLGCRDNTGGIKSVYILSGSVTSVTDASEGLINAITA |
| Ga0135227_10344141 | 3300029302 | Marine Harbor | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDTITDASETTND |
| Ga0307380_101016404 | 3300031539 | Soil | MSSCDITSGFTLGCRDNTGGLKNIYILSGSISSTSGTTGLLSAISGSGT |
| Ga0307379_103798451 | 3300031565 | Soil | MSTCDITSGFTLGCRDNTGGIANLYILSGSITSVTDASEGLISGITGSGEF |
| Ga0307376_100287241 | 3300031578 | Soil | MSTCDITSGFTLGCRDNTGGIKNLYILSGSIDTIDTASEGLINGITGSGV |
| Ga0307375_102816911 | 3300031669 | Soil | MATCDITSGFTLSCRDNSGGIRNLYILSGSVSSITNASEGLINAMTGSG |
| Ga0307377_101490971 | 3300031673 | Soil | MACDITSGFALGCRDNTGGITNLYILSGSITTVNTVSEGLING |
| Ga0307377_101513551 | 3300031673 | Soil | MSTCDITSGFTLGCRDNSGGIKNLYILSGSIDTLGTASEGLINAM |
| Ga0307377_106199401 | 3300031673 | Soil | MSTCDITSGFTLGCRDNSGGIKNLYILSGSVDSIATA |
| Ga0335028_0638097_431_565 | 3300034071 | Freshwater | MSTTCDIVSGFTLGCRDNTGGLKNIYILSGSISSTGGTEGLISTI |
| Ga0335027_0040352_3_155 | 3300034101 | Freshwater | MPAGCDITSGFALGCRDNTGGIRNIYILSGSISNITYQSSAQGLITGISGS |
| Ga0335048_0075228_1_105 | 3300034356 | Freshwater | MACDITSGFQLGCRDNTGGLKSIYILSGSITSVSG |
| ⦗Top⦘ |