NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095520

Metagenome / Metatranscriptome Family F095520

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095520
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 127 residues
Representative Sequence MKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Number of Associated Samples 100
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.86 %
% of genes near scaffold ends (potentially truncated) 28.57 %
% of genes from short scaffolds (< 2000 bps) 61.90 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(56.190 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 12.40%    β-sheet: 4.65%    Coil/Unstructured: 82.95%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF14342DUF4396 38.10
PF02321OEP 15.24
PF13411MerR_1 7.62
PF00296Bac_luciferase 5.71
PF16576HlyD_D23 2.86
PF12681Glyoxalase_2 1.90
PF02492cobW 0.95
PF03929PepSY_TM 0.95
PF00376MerR 0.95
PF01467CTP_transf_like 0.95
PF00406ADK 0.95
PF00440TetR_N 0.95
PF00903Glyoxalase 0.95
PF10728DUF2520 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 30.48
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 5.71
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.95
COG3182PepSY-associated TM regionFunction unknown [S] 0.95
COG3295Uncharacterized conserved proteinFunction unknown [S] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10001072All Organisms → cellular organisms → Bacteria → Proteobacteria18302Open in IMG/M
3300000117|DelMOWin2010_c10006475All Organisms → cellular organisms → Bacteria7020Open in IMG/M
3300000117|DelMOWin2010_c10037425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2284Open in IMG/M
3300000928|OpTDRAFT_10079967All Organisms → cellular organisms → Bacteria → Proteobacteria2296Open in IMG/M
3300001347|JGI20156J14371_10006448All Organisms → cellular organisms → Bacteria7913Open in IMG/M
3300001351|JGI20153J14318_10001233All Organisms → cellular organisms → Bacteria → Proteobacteria20000Open in IMG/M
3300001353|JGI20159J14440_10016093All Organisms → cellular organisms → Bacteria → Proteobacteria3711Open in IMG/M
3300003583|JGI26253J51717_1004277All Organisms → cellular organisms → Bacteria → Proteobacteria4912Open in IMG/M
3300003592|JGI26246J51724_1004969All Organisms → cellular organisms → Bacteria → Proteobacteria5191Open in IMG/M
3300004276|Ga0066610_10156564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium758Open in IMG/M
3300004279|Ga0066605_10107975All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1147Open in IMG/M
3300004279|Ga0066605_10135229All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium990Open in IMG/M
3300005239|Ga0073579_1172754All Organisms → cellular organisms → Bacteria → Proteobacteria42084Open in IMG/M
3300005941|Ga0070743_10040856All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1589Open in IMG/M
3300006027|Ga0075462_10246142All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium530Open in IMG/M
3300006399|Ga0075495_1081606All Organisms → cellular organisms → Bacteria → Proteobacteria1617Open in IMG/M
3300006803|Ga0075467_10660173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium533Open in IMG/M
3300007229|Ga0075468_10001405All Organisms → cellular organisms → Bacteria → Proteobacteria10218Open in IMG/M
3300007543|Ga0102853_1046670All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium754Open in IMG/M
3300007552|Ga0102818_1073486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium674Open in IMG/M
3300007555|Ga0102817_1040885All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1017Open in IMG/M
3300007637|Ga0102906_1027263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1721Open in IMG/M
3300007655|Ga0102825_1024984All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1218Open in IMG/M
3300007665|Ga0102908_1034131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium975Open in IMG/M
3300007681|Ga0102824_1043190All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1193Open in IMG/M
3300007692|Ga0102823_1045251All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1184Open in IMG/M
3300007862|Ga0105737_1096330All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium745Open in IMG/M
3300007954|Ga0105739_1025564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1226Open in IMG/M
3300008699|Ga0103617_100413All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium989Open in IMG/M
3300008956|Ga0104261_1011113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1016Open in IMG/M
3300008961|Ga0102887_1025515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2056Open in IMG/M
3300008964|Ga0102889_1049884All Organisms → cellular organisms → Bacteria → Proteobacteria1273Open in IMG/M
3300009002|Ga0102810_1054476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1280Open in IMG/M
3300009054|Ga0102826_1161790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium534Open in IMG/M
3300009058|Ga0102854_1122045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium746Open in IMG/M
3300009077|Ga0115552_1234993All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium743Open in IMG/M
3300009079|Ga0102814_10018023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4095Open in IMG/M
3300009086|Ga0102812_10049934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2332Open in IMG/M
3300009124|Ga0118687_10345585All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium567Open in IMG/M
3300009142|Ga0102885_1147005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium575Open in IMG/M
3300009435|Ga0115546_1015201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3385Open in IMG/M
3300009437|Ga0115556_1035691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2158Open in IMG/M
3300009449|Ga0115558_1285632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300009449|Ga0115558_1290384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium652Open in IMG/M
3300009497|Ga0115569_10035270All Organisms → cellular organisms → Bacteria → Proteobacteria2897Open in IMG/M
3300009498|Ga0115568_10039271All Organisms → cellular organisms → Bacteria → Proteobacteria2566Open in IMG/M
3300009606|Ga0115102_10007544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium860Open in IMG/M
3300010309|Ga0102890_1040384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium917Open in IMG/M
3300010368|Ga0129324_10135870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1034Open in IMG/M
3300012470|Ga0129329_1084522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium990Open in IMG/M
3300012516|Ga0129325_1189412All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium873Open in IMG/M
3300013010|Ga0129327_10014753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4207Open in IMG/M
3300016734|Ga0182092_1233791All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1118Open in IMG/M
3300016745|Ga0182093_1844318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium825Open in IMG/M
3300016797|Ga0182090_1652099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4594Open in IMG/M
3300017950|Ga0181607_10027945All Organisms → cellular organisms → Bacteria → Proteobacteria4124Open in IMG/M
3300018041|Ga0181601_10105969All Organisms → cellular organisms → Bacteria → Proteobacteria1806Open in IMG/M
3300018048|Ga0181606_10011921All Organisms → cellular organisms → Bacteria → Proteobacteria6829Open in IMG/M
3300019214|Ga0180037_1136965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300020165|Ga0206125_10003689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria14312Open in IMG/M
3300020169|Ga0206127_1002617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria17542Open in IMG/M
3300020175|Ga0206124_10019140All Organisms → cellular organisms → Bacteria → Proteobacteria3454Open in IMG/M
3300020182|Ga0206129_10024945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4464Open in IMG/M
3300020185|Ga0206131_10005081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria14091Open in IMG/M
3300020191|Ga0181604_10262666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium803Open in IMG/M
3300021305|Ga0210296_1087155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1090Open in IMG/M
3300021378|Ga0213861_10064494All Organisms → cellular organisms → Bacteria → Proteobacteria2295Open in IMG/M
3300021389|Ga0213868_10273614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium977Open in IMG/M
3300021957|Ga0222717_10033809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3372Open in IMG/M
3300021958|Ga0222718_10091194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1815Open in IMG/M
3300021958|Ga0222718_10108578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1624Open in IMG/M
3300021959|Ga0222716_10080636All Organisms → cellular organisms → Bacteria → Proteobacteria2236Open in IMG/M
3300021959|Ga0222716_10081612All Organisms → cellular organisms → Bacteria → Proteobacteria2219Open in IMG/M
3300021960|Ga0222715_10043525All Organisms → cellular organisms → Bacteria → Proteobacteria3144Open in IMG/M
3300022369|Ga0210310_1009795All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium929Open in IMG/M
(restricted) 3300022920|Ga0233426_10000131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria86177Open in IMG/M
3300022927|Ga0255769_10402610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium521Open in IMG/M
(restricted) 3300022931|Ga0233433_10047235All Organisms → cellular organisms → Bacteria → Proteobacteria2344Open in IMG/M
(restricted) 3300022933|Ga0233427_10200954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium880Open in IMG/M
(restricted) 3300023109|Ga0233432_10042843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2938Open in IMG/M
3300023683|Ga0228681_1013370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium924Open in IMG/M
3300024348|Ga0244776_10167225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1589Open in IMG/M
3300025570|Ga0208660_1034815All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1353Open in IMG/M
3300025577|Ga0209304_1039201All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1319Open in IMG/M
3300025620|Ga0209405_1147010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300025621|Ga0209504_1003452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria9869Open in IMG/M
3300025636|Ga0209136_1143287All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
3300025640|Ga0209198_1108661All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium846Open in IMG/M
3300025641|Ga0209833_1057714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1275Open in IMG/M
3300025680|Ga0209306_1134050All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium713Open in IMG/M
3300025684|Ga0209652_1037594All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1954Open in IMG/M
3300025688|Ga0209140_1140289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium714Open in IMG/M
3300025709|Ga0209044_1138153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium722Open in IMG/M
3300025806|Ga0208545_1037722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1507Open in IMG/M
3300025830|Ga0209832_1148759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium692Open in IMG/M
3300025849|Ga0209603_1027964All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3363Open in IMG/M
3300025890|Ga0209631_10024954All Organisms → cellular organisms → Bacteria → Proteobacteria4555Open in IMG/M
3300027315|Ga0208949_1047254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium797Open in IMG/M
3300027572|Ga0208964_1124874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium549Open in IMG/M
3300027582|Ga0208971_1011642All Organisms → cellular organisms → Bacteria → Proteobacteria3341Open in IMG/M
3300028137|Ga0256412_1143662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium879Open in IMG/M
3300028189|Ga0257127_1072121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1071Open in IMG/M
3300028196|Ga0257114_1073398All Organisms → cellular organisms → Bacteria → Proteobacteria1450Open in IMG/M
3300028284|Ga0257120_1007375All Organisms → cellular organisms → Bacteria → Proteobacteria4959Open in IMG/M
3300031766|Ga0315322_10422392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium887Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine20.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine14.29%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine8.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.62%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.62%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.71%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater4.76%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.81%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.81%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.81%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.81%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine2.86%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.86%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.90%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.90%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.95%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.95%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.95%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.95%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.95%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.95%
North SeaEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001347Pelagic Microbial community sample from North Sea - COGITO 998_met_06EnvironmentalOpen in IMG/M
3300001351Pelagic Microbial community sample from North Sea - COGITO 998_met_03EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300004276Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165mEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300008699Microbial communities of saline water collected from the North Sea in Germany - HE327_1EnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016745Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016797Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025641Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025688Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025709Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300027315Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028189Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135mEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_10001072113300000115MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
DelMOWin2010_1000647593300000117MarineMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
DelMOWin2010_1003742543300000117MarineMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSIEMVGMAHHGGHEGPGAIMTSTDADAACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA*
OpTDRAFT_1007996723300000928Freshwater And MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAXXXXXXGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
JGI20156J14371_10006448113300001347Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCXSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
JGI20153J14318_10001233123300001351Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
JGI20159J14440_1001609353300001353Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGXEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
JGI26253J51717_100427753300003583MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
JGI26246J51724_100496953300003592MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0066610_1015656423300004276MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPKDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0066605_1010797523300004279MarineVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHNEMAGMSRHDGHEMLGAMMAPTEADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKVLDFIFDIVPPPPKPA*
Ga0066605_1013522913300004279MarineRQTRHMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHYDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0073579_1172754323300005239MarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASSETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0070743_1004085613300005941EstuarineCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0075462_1024614213300006027AqueousMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLVVHSIEMVGMAHHGGHEGPGAIMTSTDADAACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPP
Ga0075495_108160623300006399AqueousMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0075467_1066017323300006803AqueousMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMPHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVFDF
Ga0075468_1000140543300007229AqueousMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102853_104667023300007543EstuarineMKRNIDQVDSTRARSSLTALVILCLSLSGMGGHVHAMIAVTDSGGFEVHHNEMAGMSHHDWHEMPLAMMAPTDADESCCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102818_107348613300007552EstuarineMKRNIDQVDSTRRPSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102817_104088523300007555EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102906_102726313300007637EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMPLAMMAPTDADEACCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102825_102498423300007655EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMCSAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102908_103413123300007665EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102824_104319023300007681EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPPHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102823_104525113300007692EstuarineRQTRHMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0105737_109633013300007862Estuary WaterMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHSEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASGDIPPRHSVTPLRSLKVLDFIFD
Ga0105739_102556423300007954Estuary WaterMKRNIDQVDSTRARSSLTALLILCSSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMPLAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0103617_10041313300008699North SeaMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0104261_101111313300008956Ocean WaterMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHYDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102887_102551533300008961EstuarineLVLCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHRVIPQRSPKVSDFLVDIVPPPPKPA*
Ga0102889_104988423300008964EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHKEMPGMSHHDGHEMRPAMMDPSDADETCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102810_105447623300009002EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102826_116179013300009054EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAATDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102854_112204513300009058EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDVDEACCQDQAPCHCSAIPQFLGVSNETPPLHRVMPQRSPKFSDFIVDIVPPPPKPA*
Ga0115552_123499323300009077Pelagic MarineRHMKRNIDQVDSTLGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102814_1001802333300009079EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNEPPSLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0102812_1004993443300009086EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0118687_1034558513300009124SedimentMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSIEMVGMAHHGGHEGPGAIMTSTDADEACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLR
Ga0102885_114700513300009142EstuarineMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHNEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKVLDFIFDI
Ga0115546_101520153300009435Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0115556_103569113300009437Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0115558_128563223300009449Pelagic MarineMKRNIDQVDSTCGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0115558_129038423300009449Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHSMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0115569_1003527043300009497Pelagic MarineMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSFEMVGMAHHGGHEGPGAIMTSTDADAACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA*
Ga0115568_1003927133300009498Pelagic MarineMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSIEMVGMAHHGGHEGPGAIMTSTDADEACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA*
Ga0115102_1000754413300009606MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQVSCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0102890_104038423300010309EstuarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA*
Ga0129324_1013587023300010368Freshwater To Marine Saline GradientLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0129329_108452223300012470AqueousMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMPHHDGHEMRLAMMAPTDADASCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0129325_118941223300012516AqueousMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0129327_1001475353300013010Freshwater To Marine Saline GradientMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA*
Ga0182092_123379123300016734Salt MarshMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0182093_184431813300016745Salt MarshMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFKDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0182090_165209963300016797Salt MarshMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPRFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0181607_1002794533300017950Salt MarshMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFKDYHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0181601_1010596923300018041Salt MarshMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0181606_1001192183300018048Salt MarshMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0180037_113696523300019214EstuarineVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHYDGHEMRSAMMAPTDADEACCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0206125_1000368943300020165SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0206127_100261753300020169SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0206124_1001914043300020175SeawaterMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0206129_1002494553300020182SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0206131_1000508153300020185SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0181604_1026266613300020191Salt MarshMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0210296_108715513300021305EstuarineMKRNIDQVDSTRARSSLTALVILCLSLSGMGGHVHVMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA
Ga0213861_1006449443300021378SeawaterMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0213868_1027361423300021389SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPAMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0222717_1003380953300021957Estuarine WaterMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRSAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA
Ga0222718_1009119423300021958Estuarine WaterMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSIEMVGMAHHGGHEGPGAIMTSTDADAACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA
Ga0222718_1010857813300021958Estuarine WaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0222716_1008063613300021959Estuarine WaterMKRNIDQADRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSFEMVGMAHHGGHEGPGAIMTSTDADAACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA
Ga0222716_1008161223300021959Estuarine WaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADASCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0222715_1004352523300021960Estuarine WaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADASCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0210310_100979513300022369EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKP
(restricted) Ga0233426_10000131113300022920SeawaterMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHNEMAGMSRHDGHEMLGAMMAPTEADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKVLDFIFDIVPPPPKPA
Ga0255769_1040261013300022927Salt MarshKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFKDYHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
(restricted) Ga0233433_1004723523300022931SeawaterMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADASCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
(restricted) Ga0233427_1020095423300022933SeawaterMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHSEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKVLDFIFDIVPPPPKPA
(restricted) Ga0233432_1004284353300023109SeawaterMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHNEMAGMSRHDGHEMLGAMMAPTEADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKV
Ga0228681_101337023300023683SeawaterMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKP
Ga0244776_1016722523300024348EstuarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMPLAMMAPTDADEACCQDQASCQCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA
Ga0208660_103481523300025570AqueousMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209304_103920123300025577Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209405_114701023300025620Pelagic MarineNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209504_100345243300025621Pelagic MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209136_114328713300025636MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSEGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADASCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFI
Ga0209198_110866113300025640Pelagic MarineHMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209833_105771423300025641Pelagic MarineTRHMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209306_113405013300025680Pelagic MarineSTCGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209652_103759413300025684MarineMKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRS
Ga0209140_114028913300025688MarineMKRNIDQVDSTRGRSSLTALLILCMSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHELRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209044_113815323300025709MarineSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0208545_103772223300025806AqueousSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHDGHEMRLEMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209832_114875923300025830Pelagic MarineCMSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209603_102796433300025849Pelagic MarineRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0209631_1002495443300025890Pelagic MarineMKRNIDQVDRMRSRSPLTAVLILCLGLSGIGGHVHAMVEMTDSAGLAVHSIEMVGMAHHGGHEGPGAIMTSTDADEACCQDQASCHCSAIPQFLGASTKMQPQHRVMPLRSPKVFDFIVDIVPPPPKLA
Ga0208949_104725413300027315MarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA
Ga0208964_112487423300027572MarineMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHSEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASGDIPPRHSVTPLRSLKV
Ga0208971_101164233300027582MarineMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHSEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA
Ga0256412_114366223300028137SeawaterMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPK
Ga0257127_107212123300028189MarineSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0257114_107339823300028196MarineMKRNIDQVDSTRARSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMAPTDADESCCQDQASCHCSAIPQFLGASNETPPLHSVMPQRSPKVSDFIFDIVPPPPKSA
Ga0257120_100737513300028284MarineMRQTIFVKTNSEQADSTRRGSLLPALLVLCLSLSGMGGHVHAMVAETDSGGREIHHNEMAGMSRHDGHEMLGAMMAPTQADESCCQDQASCHCSAIPQFLGASDDMPPRHSVTPLRSLKVLDFIFDIVPPPPKPA
Ga0315322_1042239213300031766SeawaterSLTALLILCLSLSGMGGHVHAMIAVTGSGGVEDHHNEMPGMSHHNGHEMRPAMMAPTDADEACCQDQASCHCSAIPQFLGASNEPPPLHRVMPQRSPKVSDFIVDIVPPPPKPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.