 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F095462 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ILHTYENAKGKTKQEFMNYMIANRLKNLIEVIDEF |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.81 % |
| % of genes from short scaffolds (< 2000 bps) | 1.90 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.143 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (18.095 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 26.67 |
| PF00535 | Glycos_transf_2 | 17.14 |
| PF01370 | Epimerase | 6.67 |
| PF00574 | CLP_protease | 3.81 |
| PF09293 | RNaseH_C | 1.90 |
| PF00908 | dTDP_sugar_isom | 0.95 |
| PF00182 | Glyco_hydro_19 | 0.95 |
| PF12705 | PDDEXK_1 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 7.62 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 7.62 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.81 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.95 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.14 % |
| All Organisms | root | All Organisms | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300007960|Ga0099850_1120756 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300008113|Ga0114346_1056120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2994 | Open in IMG/M |
| 3300019784|Ga0181359_1003975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4625 | Open in IMG/M |
| 3300034062|Ga0334995_0551836 | Not Available | 680 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.86% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.90% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.90% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.95% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.95% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.95% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.95% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300002297 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100879974 | 3300000116 | Marine | PEELKEKILHSYDTFQVKTKQHFMNYMIKKRLKNLLEVIDEF* |
| RCM27_101010313 | 3300001836 | Marine Plankton | SIIDSYESTKPATKQKFMNYMISKRLKNLLEVIDDF* |
| B570J29603_1100092 | 3300002297 | Freshwater | LKESILDSFENTKANSKQRFMTYMIENRLKNLIEVIDEF* |
| B570J29032_1089424101 | 3300002408 | Freshwater | SILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF* |
| B570J40625_1017342991 | 3300002835 | Freshwater | TQIPESLQKTIIDTYENTSAKTKQVFMNYMIANRLKNLLEIIDEF* |
| JGI25912J50252_100433923 | 3300003412 | Freshwater Lake | TKIPETLKTSILDTYEAAKGKTRQEFMNYMIANRLKNLIEVIDEF* |
| Ga0049080_102566371 | 3300005582 | Freshwater Lentic | KESILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF* |
| Ga0070744_101310713 | 3300006484 | Estuarine | LHTYDEAKGKTKQEFMNYIITNRLKNLLEVIDEF* |
| Ga0070749_103674473 | 3300006802 | Aqueous | TKIPERLSTEILHTYDNSSGHTKQEFMNYMIANRLKNLIEVLNDF* |
| Ga0102921_13341922 | 3300007603 | Estuarine | PERLANEILHTYESAVGHSKQDFLNYMIANRLKNLIEVLDDF* |
| Ga0102859_11016773 | 3300007708 | Estuarine | RNEMLIDLTKIPERLANEILHTYESAIGHSKQDFLNYMIANRLKNLIEVLDDF* |
| Ga0099850_11207561 | 3300007960 | Aqueous | QEILHTYENAKGKTKQQFMNYMIANRLKNLLEVIDEF* |
| Ga0099850_11483313 | 3300007960 | Aqueous | LHTYENAKGKTKQQFMNYMIANRLKNLIEVIDEF* |
| Ga0105746_13214851 | 3300007973 | Estuary Water | ETLKTSILDTYETAKGKTRQEFMNYMIANRLKNLIEVIDEF* |
| Ga0114343_11745851 | 3300008110 | Freshwater, Plankton | GAISKNIIDTYIDTKPATRQQFMNYMIANRLKNLLEVIDEF* |
| Ga0114346_10235571 | 3300008113 | Freshwater, Plankton | KLATEILHTYENASCRSKQEFMNYMIANRLKNLIEVMDDF* |
| Ga0114346_10561208 | 3300008113 | Freshwater, Plankton | ILDTYEAAKGKTRQEFMNYMIANRLKNLIEVIDEF* |
| Ga0114973_100428001 | 3300009068 | Freshwater Lake | KQSIIDTYENAKGHTKQEFMNYMIANRLKNLIEVIDEF* |
| Ga0114973_104435081 | 3300009068 | Freshwater Lake | ILDTYETAKGKTRQEFMNYMIANRLKNLLEVIDEF* |
| Ga0114968_100076411 | 3300009155 | Freshwater Lake | LDTYESTKAKPKQEFMNYLIANRLKNLLEVIDEF* |
| Ga0114968_106926541 | 3300009155 | Freshwater Lake | QTILDTYESTKAKPKQEFMNYLIANRLKNLLEVIDEF* |
| Ga0114977_107410942 | 3300009158 | Freshwater Lake | EALKETILHTYEEAKGKTKQEFMNYIITNRLKNLLEVIDEF* |
| Ga0114966_101767321 | 3300009161 | Freshwater Lake | SLQQTILDTYESTKAKPKQEFMNYLIANRLKNLLEVIDEF* |
| Ga0105102_101485304 | 3300009165 | Freshwater Sediment | LTTYSDTKPANRQQFMNYMIANRLKNLLEIIDEF* |
| Ga0105102_101804033 | 3300009165 | Freshwater Sediment | DLTKIPAKVQEGILNSYETVKGKTKQEFMNYMIANRLKNLIEVAHEF* |
| Ga0114969_104791441 | 3300009181 | Freshwater Lake | KSIIDSYENTKGHTRQEFLSYMIANRLTNLIGIIDEF* |
| Ga0114969_107925871 | 3300009181 | Freshwater Lake | LKVAILDTYDASKGKTKQQFMNYMIANRLKNLLEVIDEF* |
| Ga0114960_10000007225 | 3300010158 | Freshwater Lake | LSEIPQSLVKTIISRYEEVKPATKQQFMNYMIANRLVNLLEALDEF* |
| Ga0114967_100369601 | 3300010160 | Freshwater Lake | LDTYENAKGKTKQEFMNYMIANRLKNLLEVIDEF* |
| Ga0136644_107880501 | 3300010334 | Freshwater Lake | ILDTYETAKGKTRQEFMNYMIANRLKNLIEVIDEF* |
| Ga0133913_124293254 | 3300010885 | Freshwater Lake | LKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF* |
| Ga0151620_10381801 | 3300011268 | Freshwater | GLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF* |
| Ga0151620_12501991 | 3300011268 | Freshwater | RNEMLIDLTKIPERLTNEILHTYENAIGHSKQDFLNYMIANRLKNLIEVLDDF* |
| Ga0157498_10432363 | 3300012666 | Freshwater, Surface Ice | LHTYEGVFGHTKQEFMNYMIANRLKNLIEVLDDF* |
| Ga0160423_106074793 | 3300012920 | Surface Seawater | LKEEILHSYDTVKGKTKQVFMNYMINKRLKNLLEVIDEF* |
| Ga0160423_106113501 | 3300012920 | Surface Seawater | LHSYDTVKGKTKQVFMNYMINKRLKNLLEVIDEF* |
| Ga0164292_101299411 | 3300013005 | Freshwater | LHTYENAKGKTKQEFMNYMIANRLKNLIEVIDEF* |
| Ga0170791_160768522 | 3300013295 | Freshwater | LKETILHTYEEAKGKTKQEFMNYIITNRLKNLLEVIDEF* |
| Ga0177922_102812361 | 3300013372 | Freshwater | SILDTYEAAKGKTRQEFMNYMIANRLKNLIEVIDEF* |
| Ga0181364_10599551 | 3300017701 | Freshwater Lake | ETIIHSYEEAKGHTKQEFMNYMIANRLKNLLEVIDEF |
| Ga0181347_10675213 | 3300017722 | Freshwater Lake | MLIDLIKIPNGLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0181347_10699511 | 3300017722 | Freshwater Lake | KEMLETIVTKYEDTKPKTRQQFMNYMIANRLKNLIEVIDEF |
| Ga0181356_10455281 | 3300017761 | Freshwater Lake | DKLKQTILDTYGESKGKTKQEFMNYLISNRLKSLIEVIDEF |
| Ga0181343_11079943 | 3300017766 | Freshwater Lake | TKIPEGLKQSILDTYGDTKAKSKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0187221_10365481 | 3300017769 | Seawater | KVPEKLKEEILHSYDTVKGKTKQVFMNYMINKRLKNLLEVIDEF |
| Ga0181358_10036381 | 3300017774 | Freshwater Lake | ILHTYENAKGKTKQEFMNYMIANRLKNLIEVIDEF |
| Ga0181349_11355091 | 3300017778 | Freshwater Lake | KESILHTYENAKGKTKQEFMNYMIANRLKNLIEVIDEF |
| Ga0181346_12519441 | 3300017780 | Freshwater Lake | SLKETILHTYEESKGKTKQEFMNYIITNRLKNLLEVIDEF |
| Ga0181348_11082183 | 3300017784 | Freshwater Lake | DLIKIPNGLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0181348_12359171 | 3300017784 | Freshwater Lake | ETILHTYEESKGKTKQEFMNYIITNRLKNLLEVIDEF |
| Ga0181348_12503472 | 3300017784 | Freshwater Lake | GMIDLRKIPETHKIAILDTYDASKGKTKQQFMNYMIANRLKNLLEVIDEF |
| Ga0169931_102153031 | 3300017788 | Freshwater | KLVNEILDTYENAKGHSKQKFMNYMIANRLKNLLEVLDDF |
| Ga0188835_10173361 | 3300019096 | Freshwater Lake | TEQILHTYDNSSGHTKQEFMNYMIANRLKNLIEVLNEF |
| Ga0181359_100397511 | 3300019784 | Freshwater Lake | KTSILDTYEAAKGKTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0181359_11453113 | 3300019784 | Freshwater Lake | ETILHTYENAKGKTKQEFMNYMIANRLKNLIEVIDEF |
| Ga0211736_103061361 | 3300020151 | Freshwater | ILHTYESAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0211736_1100029921 | 3300020151 | Freshwater | ANEILHTYESAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0211726_106556134 | 3300020161 | Freshwater | VESILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF |
| Ga0211729_102841771 | 3300020172 | Freshwater | QSIIDTYENAKGHTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0211731_106227461 | 3300020205 | Freshwater | ILDTYEAAKGKTRQEFMNYMIANRLKNLLEVIDEF |
| Ga0208232_10350483 | 3300020527 | Freshwater | PERLTNEILHTYENAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0213858_105694842 | 3300021356 | Seawater | EILHSYDTVKGKTKQVFMNYMINKRLKNLLEVIDEF |
| Ga0213859_103453583 | 3300021364 | Seawater | EEILHSYDTVKGKTKQVFMNYMINKRLKNLLEVIDEF |
| Ga0222713_102697563 | 3300021962 | Estuarine Water | ILASYDETKPKTRSVFMNYMIANKLKSLIEVIDEF |
| Ga0222712_101850741 | 3300021963 | Estuarine Water | PENLKTAILDTYETAKGKTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0222712_104735473 | 3300021963 | Estuarine Water | PERLANEILHTYESAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0255147_10357651 | 3300024289 | Freshwater | LTKVPETLQKNIIDTYESTAGHTKQQFMNYMIANKLKNLIEVIDEF |
| Ga0244775_111099751 | 3300024346 | Estuarine | NGLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0208546_10098611 | 3300025585 | Aqueous | QIVSEILDKYESTQAKTKSVFMNYMIANKLKNLIEVLDEF |
| Ga0209443_12225521 | 3300027707 | Freshwater Lake | LIKIPNGLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0209084_10002741 | 3300027749 | Freshwater Lake | LSEIPQSLVKTIISRYEEVKPATKQQFMNYMIANRLVNLLEALDEF |
| Ga0209084_11745903 | 3300027749 | Freshwater Lake | LTKIPENLKESILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF |
| Ga0209086_100558375 | 3300027770 | Freshwater Lake | KIPERLTNEILHTYENAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0209358_102886923 | 3300027804 | Freshwater Lake | ENLKTAILDTYENAKGKTKQEFMNYMIANRLKNLLEVIDEF |
| Ga0209358_103300301 | 3300027804 | Freshwater Lake | LATEILHTYENASCRSKQEFMNYMIANRLKNLIEVMDDF |
| Ga0209229_104338842 | 3300027805 | Freshwater And Sediment | STYNETKPASRQQFMNYMIANRLKNLLEVIDEFXDK |
| Ga0209354_102304531 | 3300027808 | Freshwater Lake | ENLKESILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF |
| Ga0209230_107933641 | 3300027836 | Freshwater And Sediment | IIDTYESTKGHTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0209191_11916403 | 3300027969 | Freshwater Lake | ETLKKSIIDTYENAKGHTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0209401_10854111 | 3300027971 | Freshwater Lake | KIPEKLKVTILDTYENAKGKTKQEFMNYMIANRLKNLLEVIDEF |
| Ga0304728_12727521 | 3300028393 | Freshwater Lake | KIPETHKIAILDTYDASKGKTKQQFMNYMIANRLKNLLEVIDEF |
| Ga0304730_10916801 | 3300028394 | Freshwater Lake | IDLTKIPENLKTAILDTYENAKGKTKQEFMNYMIANRLKNLLEVIDEF |
| (restricted) Ga0247840_105737711 | 3300028581 | Freshwater | EILHTYESAIGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0315907_106014931 | 3300031758 | Freshwater | VTDILNTYENTQGKTKSVFMNYMIVNKLKNLIEVIDEF |
| Ga0315907_107533931 | 3300031758 | Freshwater | TRVPEPLQKSIIDTYESAAGHTKQHFMNYMIANKLKNLIEVIDEF |
| Ga0315899_111273153 | 3300031784 | Freshwater | TLKETILHSYEEAKGHTKQEFMNYMIANRLKNLLEVIDEF |
| Ga0315900_104806223 | 3300031787 | Freshwater | ILHTYENAKGHSKQEFMNYMIANRLKNLIEVIDEF |
| Ga0315909_107132611 | 3300031857 | Freshwater | TTEILHTYESAKGSSKQDFMNYMIANRLKNLIEVLDDF |
| Ga0315904_109070383 | 3300031951 | Freshwater | SLKTAILDTYESAKGHSKQEFMNYMIANRLKNLIEVIDEF |
| Ga0315904_109539621 | 3300031951 | Freshwater | LAKIPDGLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0315901_100674881 | 3300031963 | Freshwater | QKSIIDTYESAAGHTKQHFMNYMIANKLKNLIEVIDEF |
| Ga0315903_106159281 | 3300032116 | Freshwater | IIDTYESTAGHTKQQFMNYMIANKLKNLIEVIDEF |
| Ga0315903_110481601 | 3300032116 | Freshwater | IDLTKIPERLTTEILHTYDNAKGSSKQEFMNYMIANRLKNLIEVLDDF |
| Ga0334994_0314336_3_128 | 3300033993 | Freshwater | ETLKETIIHSYEEAKGHTKQEFMNYMIANRLKNLLEVIDEF |
| Ga0335003_0453044_428_538 | 3300033995 | Freshwater | SILSTYEELKPSTRQQFMNYMIANRLTNLLEVIDEF |
| Ga0334985_0731184_3_110 | 3300034018 | Freshwater | ILHTYENAKGKTKQEFMNYLIANRLKNLFNVIDEF |
| Ga0335004_0181687_1192_1329 | 3300034021 | Freshwater | TKIPERLANEILHTYESAVGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0334995_0551836_559_678 | 3300034062 | Freshwater | LKQSIIDTYESTKGHTRQEFMNYMIANRLKNLIEVIDEF |
| Ga0335010_0135757_1435_1578 | 3300034092 | Freshwater | DLNLIPETLKRSILDTYENTKGHSRQVFMNYMITNRLKNLLEVIDEF |
| Ga0335035_0541684_505_627 | 3300034105 | Freshwater | NLKESILHTYENAKGKTKQEFMNYMIANRLKNLFNVIDEF |
| Ga0335051_0132738_1120_1272 | 3300034109 | Freshwater | MLIDLTKIPERLANEILHTYESAVGHSKQDFLNYMIANRLKNLIEVLDDF |
| Ga0335058_0187066_1104_1211 | 3300034121 | Freshwater | IVEVYETTQSKTKQHFMNYMIANKLKNLIEVLDEF |
| Ga0335065_0431720_680_802 | 3300034200 | Freshwater | GLKQNILDTYGDTKAKTKQQFMNYLMSNRLKNLLEVIDEF |
| Ga0335049_0746702_1_114 | 3300034272 | Freshwater | RSILDTYENTKGHSRQVFMNYMITNRLKNLLEVIDEF |
| Ga0335007_0013713_6328_6438 | 3300034283 | Freshwater | TIIHSYEEAKGHTKQEFMNYMIANRLKNLLEVIDEF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |