NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095431

Metagenome / Metatranscriptome Family F095431

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095431
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 39 residues
Representative Sequence MAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR
Number of Associated Samples 90
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.62 %
% of genes near scaffold ends (potentially truncated) 17.14 %
% of genes from short scaffolds (< 2000 bps) 79.05 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.524 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(19.048 % of family members)
Environment Ontology (ENVO) Unclassified
(22.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.952 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00034Cytochrom_C 48.57
PF00116COX2 23.81
PF00115COX1 3.81
PF00510COX3 2.86
PF00344SecY 1.90
PF13442Cytochrome_CBB3 0.95
PF13795HupE_UreJ_2 0.95
PF04545Sigma70_r4 0.95
PF02545Maf 0.95
PF01058Oxidored_q6 0.95
PF03626COX4_pro 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 23.81
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 23.81
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 2.86
COG0201Preprotein translocase subunit SecYIntracellular trafficking, secretion, and vesicular transport [U] 1.90
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.95
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 0.95
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.95
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.95
COG3125Heme/copper-type cytochrome/quinol oxidase, subunit 4Energy production and conversion [C] 0.95
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.52 %
UnclassifiedrootN/A10.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104639657All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium639Open in IMG/M
3300003267|soilL1_10185795All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300005093|Ga0062594_100749252All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005093|Ga0062594_101321915All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005175|Ga0066673_10621254All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005330|Ga0070690_100276284Not Available1197Open in IMG/M
3300005332|Ga0066388_103260840All Organisms → cellular organisms → Bacteria → Proteobacteria829Open in IMG/M
3300005340|Ga0070689_100002893All Organisms → cellular organisms → Bacteria11293Open in IMG/M
3300005343|Ga0070687_100396448All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300005440|Ga0070705_101601569All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005441|Ga0070700_101207629All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium632Open in IMG/M
3300005467|Ga0070706_101130475All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005526|Ga0073909_10047718All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300005535|Ga0070684_100209830All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300005713|Ga0066905_100008167All Organisms → cellular organisms → Bacteria4750Open in IMG/M
3300005764|Ga0066903_100088734All Organisms → cellular organisms → Bacteria4092Open in IMG/M
3300005764|Ga0066903_100254415All Organisms → cellular organisms → Bacteria2715Open in IMG/M
3300005764|Ga0066903_100393401All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300005764|Ga0066903_102596186Not Available982Open in IMG/M
3300005764|Ga0066903_102952612All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300005831|Ga0074471_10658597All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium563Open in IMG/M
3300005833|Ga0074472_10684763All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005840|Ga0068870_11180771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium553Open in IMG/M
3300006580|Ga0074049_12817060All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006606|Ga0074062_12052776Not Available1030Open in IMG/M
3300006755|Ga0079222_10165707All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300006844|Ga0075428_100196397All Organisms → cellular organisms → Bacteria2182Open in IMG/M
3300006845|Ga0075421_101735511All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium674Open in IMG/M
3300006852|Ga0075433_10142043All Organisms → cellular organisms → Bacteria2134Open in IMG/M
3300006852|Ga0075433_11620654All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300006853|Ga0075420_100575688All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium972Open in IMG/M
3300006853|Ga0075420_101014769All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium714Open in IMG/M
3300006854|Ga0075425_100257196All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300006854|Ga0075425_101223947All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300006871|Ga0075434_100535241All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300006880|Ga0075429_100005516All Organisms → cellular organisms → Bacteria10893Open in IMG/M
3300006904|Ga0075424_101446658All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300006914|Ga0075436_100199470All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300006914|Ga0075436_101072225All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006953|Ga0074063_13177246All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300007076|Ga0075435_101117862All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009089|Ga0099828_11057066All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300009094|Ga0111539_10749684All Organisms → cellular organisms → Bacteria → Proteobacteria1136Open in IMG/M
3300009147|Ga0114129_11623782Not Available791Open in IMG/M
3300009225|Ga0103851_1000293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA0054979Open in IMG/M
3300009235|Ga0103857_10147329All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010359|Ga0126376_11334329All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium739Open in IMG/M
3300010359|Ga0126376_12195632All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium597Open in IMG/M
3300010361|Ga0126378_10704844All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300010366|Ga0126379_10047482All Organisms → cellular organisms → Bacteria3511Open in IMG/M
3300010401|Ga0134121_10044647All Organisms → cellular organisms → Bacteria3628Open in IMG/M
3300011444|Ga0137463_1115565All Organisms → cellular organisms → Bacteria → Proteobacteria1010Open in IMG/M
3300012358|Ga0137368_10352899All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300012397|Ga0134056_1018896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300012918|Ga0137396_10586164All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300012948|Ga0126375_11715250All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300015245|Ga0137409_10311640All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300015245|Ga0137409_11041750Not Available656Open in IMG/M
3300015371|Ga0132258_10431181All Organisms → cellular organisms → Bacteria → Proteobacteria3283Open in IMG/M
3300018083|Ga0184628_10432381Not Available686Open in IMG/M
3300018433|Ga0066667_11982765All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300018469|Ga0190270_11382768All Organisms → cellular organisms → Bacteria → Proteobacteria749Open in IMG/M
3300019458|Ga0187892_10015094All Organisms → cellular organisms → Bacteria → Proteobacteria8464Open in IMG/M
3300024232|Ga0247664_1027508All Organisms → cellular organisms → Bacteria → Proteobacteria1323Open in IMG/M
3300024254|Ga0247661_1009116All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300024254|Ga0247661_1086779All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium588Open in IMG/M
3300024254|Ga0247661_1119634All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium503Open in IMG/M
3300024298|Ga0255178_1081736All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300025906|Ga0207699_10609472All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium795Open in IMG/M
3300025918|Ga0207662_10210859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1261Open in IMG/M
3300025930|Ga0207701_10041150All Organisms → cellular organisms → Bacteria → Proteobacteria4297Open in IMG/M
3300025936|Ga0207670_10000052All Organisms → cellular organisms → Bacteria86188Open in IMG/M
3300026075|Ga0207708_10355051Not Available1204Open in IMG/M
3300026118|Ga0207675_100086573All Organisms → cellular organisms → Bacteria → Proteobacteria2942Open in IMG/M
3300026562|Ga0255285_1028784All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300027787|Ga0209074_10151726All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300027874|Ga0209465_10220260All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium948Open in IMG/M
3300027880|Ga0209481_10002741All Organisms → cellular organisms → Bacteria7302Open in IMG/M
3300027880|Ga0209481_10454367All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300027903|Ga0209488_10913935All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium614Open in IMG/M
3300027907|Ga0207428_10089400All Organisms → cellular organisms → Bacteria2394Open in IMG/M
3300027909|Ga0209382_10556103Not Available1255Open in IMG/M
3300028380|Ga0268265_10651863All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300028802|Ga0307503_10283027All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031170|Ga0307498_10066218All Organisms → cellular organisms → Bacteria1026Open in IMG/M
(restricted) 3300031197|Ga0255310_10136029Not Available671Open in IMG/M
(restricted) 3300031248|Ga0255312_1204162All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031538|Ga0310888_10103740All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300031538|Ga0310888_10111818All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300031543|Ga0318516_10057591All Organisms → cellular organisms → Bacteria2129Open in IMG/M
3300031719|Ga0306917_10590310Not Available873Open in IMG/M
3300031740|Ga0307468_100619552All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300031820|Ga0307473_10451963All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300031879|Ga0306919_11394199All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium529Open in IMG/M
3300031908|Ga0310900_10094907All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300031943|Ga0310885_10855178All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium519Open in IMG/M
3300032064|Ga0318510_10341395Not Available630Open in IMG/M
3300032076|Ga0306924_10451082All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300032122|Ga0310895_10608405All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium561Open in IMG/M
3300032144|Ga0315910_10709336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium781Open in IMG/M
3300032174|Ga0307470_11211199All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300032180|Ga0307471_101379439All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300032261|Ga0306920_100104435All Organisms → cellular organisms → Bacteria → Proteobacteria4196Open in IMG/M
3300033412|Ga0310810_10145563All Organisms → cellular organisms → Bacteria → Proteobacteria2760Open in IMG/M
3300034664|Ga0314786_148326All Organisms → cellular organisms → Bacteria547Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere19.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.86%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.90%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.90%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024298Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10463965723300000364SoilMAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFXLR*
soilL1_1018579533300003267Sugarcane Root And Bulk SoilMAGDGFEEGWAENTAKVTFIMTVVGVILFVGSVFWFILN*
Ga0062594_10074925223300005093SoilMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILR*
Ga0062594_10132191523300005093SoilMAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFILR*
Ga0066673_1062125423300005175SoilMAGDGFEPDWDVNTARMTMRFTVLGVLLFVGCVMLFILR*
Ga0070690_10027628423300005330Switchgrass RhizosphereMAGDGFEEDWAVNTARWTMRFTVLGVVLFVACVFLFILR*
Ga0066388_10326084023300005332Tropical Forest SoilMAGDGFEEDWAANTARWTMRFTVLGVLLFVGCVFLFILR*
Ga0070689_10000289333300005340Switchgrass RhizosphereMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIMR*
Ga0070687_10039644823300005343Switchgrass RhizosphereMAGEHFEDDWANNTARWTMRFTVLGVVLFVGCVFLFIFR*
Ga0070705_10160156923300005440Corn, Switchgrass And Miscanthus RhizosphereMAGDGFEPDWDVNTARWTMRFTVLGVVLFVGCVMLFIFK*
Ga0070700_10120762913300005441Corn, Switchgrass And Miscanthus RhizosphereMAGDGFDEKWAAETAKLTVIYTVVGVVLFVGSVFLFIFPEGTPR*
Ga0070706_10113047513300005467Corn, Switchgrass And Miscanthus RhizosphereMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILK*
Ga0073909_1004771833300005526Surface SoilMAGDGFDDDWADSTARYTFIFTVVGVVLFVAAVFLFIF*
Ga0070684_10020983033300005535Corn RhizosphereMAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR*
Ga0066905_10000816753300005713Tropical Forest SoilMAGDGFEPDWAEKTARLTFIFTIVGVVLFVGSVFVFIML*
Ga0066903_10008873463300005764Tropical Forest SoilMAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF*
Ga0066903_10025441513300005764Tropical Forest SoilMAGDGFEEDWAVNTARWTMIFAVLGVVLFVGCVFLFIL*
Ga0066903_10039340153300005764Tropical Forest SoilMAGDGFEKDWDLNTARWTMRFTILGVVLFVGSVFVFILR*
Ga0066903_10259618623300005764Tropical Forest SoilMAGDGFEENWATNTARWTMRFTVLGVVLFVGCVFLFILR*
Ga0066903_10295261223300005764Tropical Forest SoilMAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR*
Ga0074471_1065859723300005831Sediment (Intertidal)MAGDGFEEGWAENTARTTFIFTVLGVVLFVGAVFLFIY*
Ga0074472_1068476323300005833Sediment (Intertidal)MAGDGFESDWADKTAKLTFLFTVVGVVLFVGAVMLFIF*
Ga0068870_1118077113300005840Miscanthus RhizosphereMAGDGFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK*
Ga0074049_1281706023300006580SoilMAGDGFEENWAADTARWTMRFTVLGVLLFVGCVFLFILR*
Ga0074062_1205277613300006606SoilMAGDGFEDDWADSTAKYTFIFTVVGVVLFVAAVFL
Ga0079222_1016570723300006755Agricultural SoilMAGDGFEEDWANNTARWTMRFTVLGVALFVGCVFLFIFR*
Ga0075428_10019639733300006844Populus RhizosphereMAGDGFEPDWANQTARWTMLFTVVGVVLFVACVFLFIF*
Ga0075421_10173551123300006845Populus RhizosphereMAGDGFEEGWAEHTAKVTFIFTVLGVVLFVGSVFLFIF*
Ga0075433_1014204333300006852Populus RhizosphereMAGDGFEEGWANNTARWTMIFTLLGVVLFVACVFLFIY*
Ga0075433_1162065423300006852Populus RhizospherePRMAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFIF*
Ga0075420_10057568813300006853Populus RhizosphereMAGDGFDEKWADNTARLTFIYTVVGVVLFVGSVFLF
Ga0075420_10101476923300006853Populus RhizosphereMAGDGFEEGWAENTAKVTFIFTVVGVVLFVGSVFLFIF*
Ga0075425_10025719623300006854Populus RhizosphereMAGDGFEENWAINTARWTMIFAVIGVVLFVACVFLFIF*
Ga0075425_10122394723300006854Populus RhizosphereMAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFVF*
Ga0075434_10053524123300006871Populus RhizosphereMAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFIF*
Ga0075429_10000551633300006880Populus RhizosphereMAGDGFDEKWADHTAKLTFIYTVVGVVLFVGSVFLFIL*
Ga0075424_10144665823300006904Populus RhizosphereMAGDGFEENWATDTARWTMRFTVLGVLLFVGCVFLFILR*
Ga0075436_10019947023300006914Populus RhizosphereMAGDGFEEDWANNTARWTMRLTVLGVVLFVGSVFLFILR*
Ga0075436_10107222523300006914Populus RhizosphereVAGEHFEDDWADTTAKWTFILTVVSVVLFVGAVFLFIF*
Ga0074063_1317724623300006953SoilMAGDGFEDDWADSTAKYTFIFTVVGVVLFVAAVFLFIF*
Ga0075435_10111786223300007076Populus RhizosphereEHFEDDWADTTAKWTFILTVVSVVLFVGAVFLFIF*
Ga0099828_1105706623300009089Vadose Zone SoilMAGDGFDDDWADSIARYTFIFTVVGVVLFVAAVFLFIF*
Ga0111539_1074968423300009094Populus RhizosphereMAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFLFIFPEGTPR*
Ga0114129_1162378213300009147Populus RhizosphereMAGDGFEEGWAVNTARWTMIFTVVGVVLFVACVFLFIY*
Ga0103851_100029373300009225River WaterMAGDGFDAKWADDTARWTFILTVLGVVLFVGAVFLFIF*
Ga0103857_1014732923300009235River WaterMAGDGFDEKWAMDTARWTFIYTAIGVVLFVGAVFLFIF*
Ga0126376_1133432923300010359Tropical Forest SoilMAGDGFDEGWANNTARWTMRFTVLGVVLFVGCVFLFIFR*
Ga0126376_1219563233300010359Tropical Forest SoilMAGDGFEEEWALNTARWTMIFAVLGVVLFVGCVFLFIM*
Ga0126378_1070484423300010361Tropical Forest SoilMAGDGFEEDWANNTARWTMRFTLLGVVLFVGCVFLFILR*
Ga0126379_1004748243300010366Tropical Forest SoilMAGDGFEEGWAENTARWTMRFTVLGVVLFVGSVFLFILR*
Ga0134121_1004464733300010401Terrestrial SoilMAGDGFEEGWADNTARWTMRFTVLGVVLFVGSVFLFILR*
Ga0137463_111556523300011444SoilMAGDGFDEKWAEQTAKLTFIYTAVGVVLFVGCVFLFIFPEGTPR*
Ga0137368_1035289923300012358Vadose Zone SoilMAGDGFEEDWAIHTARWTMVFTVLGVVLFVACVFLFIY*
Ga0134056_101889613300012397Grasslands SoilMAGDGFEEGWANNTARWTMIFTVVGVVLFVACVFLFIF*
Ga0137396_1058616423300012918Vadose Zone SoilMAGDGFDEDWADSVAKYTFIFTVVSVVLFVAAVFLFIF*
Ga0126375_1171525013300012948Tropical Forest SoilGRRMAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF*
Ga0137409_1031164023300015245Vadose Zone SoilVAGDGFEDNWAETTARWTVILTVVGVVLFVGCVFLFIF*
Ga0137409_1104175023300015245Vadose Zone SoilVAGDKFDDDWADKTAKWTFLYTVVGVVAFLIAVFVWIF*
Ga0132258_1043118123300015371Arabidopsis RhizosphereMAGDGFEEHWADNTARWTMRFTVLGVLLFVGCVFLFIFR*
Ga0184628_1043238113300018083Groundwater SedimentMAGDGFDEKWAEQTAKLTFIYTLVGVVLFVGSVFLFIFPEGTPR
Ga0066667_1198276523300018433Grasslands SoilGREPTMAGDGFDDDWADSTAKYTFIFTVVGVVLFVAAVFLFIF
Ga0190270_1138276823300018469SoilMAGDGFDEKWAEHTAKLTFIYTVVGVVLFVGSVFLFIF
Ga0187892_10015094103300019458Bio-OozeMAGDGFDEDWAEHTARLTFIFTVVGVALFVGAVFLFIF
Ga0247664_102750813300024232SoilAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR
Ga0247661_100911633300024254SoilMAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR
Ga0247661_108677923300024254SoilMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIFR
Ga0247661_111963433300024254SoilMAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFL
Ga0255178_108173613300024298FreshwaterPSMAGDGFDEKWAHETARLTFIYTVVGVVLFVGAVLLFIR
Ga0207699_1060947213300025906Corn, Switchgrass And Miscanthus RhizosphereMAGDHFEPDWADKTAKWTFLWTVAGVIAFVIAVYVWI
Ga0207662_1021085923300025918Switchgrass RhizosphereMAGEHFEDDWANNTARWTMRFTVLGVVLFVGCVFLFIFR
Ga0207701_1004115013300025930Corn, Switchgrass And Miscanthus RhizosphereMAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR
Ga0207670_10000052313300025936Switchgrass RhizosphereMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIMR
Ga0207708_1035505113300026075Corn, Switchgrass And Miscanthus RhizosphereMAGDGFDEKWAADTAKLTVIYTVVGVVLFVGSVFLFIFPEGTPR
Ga0207675_10008657343300026118Switchgrass RhizosphereGFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK
Ga0255285_102878423300026562FreshwaterMAGDGFDEKWAHETARLTFIYTVVGVVLFVGAVLLFIR
Ga0209074_1015172623300027787Agricultural SoilMAGDGFEEDWANNTARWTMRFTVLGVALFVGCVFLFIFR
Ga0209465_1022026013300027874Tropical Forest SoilMAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF
Ga0209481_1000274173300027880Populus RhizosphereMAGDGFDEKWADHTAKLTFIYTVVGVVLFVGSVFLFIL
Ga0209481_1045436723300027880Populus RhizosphereMAGDGFEPDWANQTARWTMLFTVVGVVLFVACVFLFIF
Ga0209488_1091393523300027903Vadose Zone SoilVAGDGFEENWADNTARYTFIFTIVGVVLFVGAVFLFIF
Ga0207428_1008940023300027907Populus RhizosphereMAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILR
Ga0209382_1055610323300027909Populus RhizosphereMAGDGFEEGWAEHTAKVTFIFTVLGVVLFVGSVFLFIF
Ga0268265_1065186323300028380Switchgrass RhizosphereMAGDGFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK
Ga0307503_1028302723300028802SoilMAGDGFDEKWAAETARLTFIYTAVGVVLFVGCVFLFIFPEGTPR
Ga0307498_1006621823300031170SoilMAGDGFDDDWADSTAKYTFIFTVVGVVLFVVCVFLFIF
(restricted) Ga0255310_1013602923300031197Sandy SoilMAGDGFEDDWADSTAKVTFIFTVLGVVLFVGAVFLFIF
(restricted) Ga0255312_120416223300031248Sandy SoilMAGDGFEENWAENTAKYTFIFTVVGVVLFVGAVFLFIF
Ga0310888_1010374033300031538SoilMAGDGFEEDWAVTTARWTMRFTVLGVVLFVACVFLFIMQ
Ga0310888_1011181823300031538SoilMAGDGFDEKWADNTARLTFIYTVVGVVLFVGSVFLFIF
Ga0318516_1005759133300031543SoilMAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLFIFR
Ga0306917_1059031013300031719SoilMAGDGFEEGWADNTARWTMRFTVLGVVLFVGRVFLFIFR
Ga0307468_10061955223300031740Hardwood Forest SoilMAGDSFEEDWAVNTARWTMRLTVIGVVLFVGCVFLFILR
Ga0307473_1045196323300031820Hardwood Forest SoilGFEENWATDTARWTMRFTVLGVLLFVGCVFLFILR
Ga0306919_1139419923300031879SoilMAGDGFEEGWADNTARWTMRFTVLGVVLFVGCVFLFIFR
Ga0310900_1009490733300031908SoilMAGDGFDEKWADNTAKLTFIYTVVGVVLFVGSVFLFIF
Ga0310885_1085517823300031943SoilMAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFLFIFPEGTPR
Ga0318510_1034139513300032064SoilMAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLF
Ga0306924_1045108233300032076SoilMAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLFIF
Ga0310895_1060840523300032122SoilMAGDGFEEDWAVSTARWTMRLTVLGVVLFVACVFLFIMQ
Ga0315910_1070933623300032144SoilMAGDGFEEKWADQTAKLTFIYTIVGVGLFVGSVFLFIF
Ga0307470_1121119923300032174Hardwood Forest SoilMAGDGFEENWAADTARWTMRFTVLGVLLFVGCVFLFILR
Ga0307471_10137943923300032180Hardwood Forest SoilMAGDGFEENWAVNTARWTMILTVVGVVLFVGCVFLFIF
Ga0306920_10010443513300032261SoilAGDGFEEGWADNTARWTMRFTVLGVVLFVGCVFLFIFR
Ga0310810_1014556343300033412SoilGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR
Ga0314786_148326_2_1153300034664SoilEKWAEQTAKLTFIYTIVGVVLFVGSVFLFIFPEGTPR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.