| Basic Information | |
|---|---|
| Family ID | F095430 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAG |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.10 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.714 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (37.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.095 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03706 | LPG_synthase_TM | 17.14 |
| PF07730 | HisKA_3 | 6.67 |
| PF03631 | Virul_fac_BrkB | 4.76 |
| PF04020 | Phage_holin_4_2 | 4.76 |
| PF06897 | DUF1269 | 2.86 |
| PF01699 | Na_Ca_ex | 1.90 |
| PF07885 | Ion_trans_2 | 1.90 |
| PF00196 | GerE | 0.95 |
| PF01266 | DAO | 0.95 |
| PF00581 | Rhodanese | 0.95 |
| PF13385 | Laminin_G_3 | 0.95 |
| PF14023 | DUF4239 | 0.95 |
| PF08402 | TOBE_2 | 0.95 |
| PF13492 | GAF_3 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 17.14 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 6.67 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 6.67 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 6.67 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 6.67 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 4.76 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 4.76 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 2.86 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.90 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.71 % |
| Unclassified | root | N/A | 14.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11772134 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300001990|JGI24737J22298_10218933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 562 | Open in IMG/M |
| 3300004114|Ga0062593_102457483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300004153|Ga0063455_100487456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300004157|Ga0062590_102690224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300004463|Ga0063356_103626186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300004463|Ga0063356_105861766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300004480|Ga0062592_101307041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300004480|Ga0062592_101753265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300005093|Ga0062594_102034484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 615 | Open in IMG/M |
| 3300005327|Ga0070658_11994332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 501 | Open in IMG/M |
| 3300005347|Ga0070668_100286147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1378 | Open in IMG/M |
| 3300005441|Ga0070700_101545938 | Not Available | 565 | Open in IMG/M |
| 3300005544|Ga0070686_100936395 | Not Available | 707 | Open in IMG/M |
| 3300005548|Ga0070665_101507924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 681 | Open in IMG/M |
| 3300005578|Ga0068854_102133938 | Not Available | 518 | Open in IMG/M |
| 3300005617|Ga0068859_100626137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1168 | Open in IMG/M |
| 3300005834|Ga0068851_10106960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1490 | Open in IMG/M |
| 3300006048|Ga0075363_100204853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1128 | Open in IMG/M |
| 3300006580|Ga0074049_12938619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300006853|Ga0075420_100375112 | Not Available | 1231 | Open in IMG/M |
| 3300006931|Ga0097620_103073100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300009101|Ga0105247_10516965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 872 | Open in IMG/M |
| 3300009168|Ga0105104_10968256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300009176|Ga0105242_12003854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300009551|Ga0105238_11180726 | Not Available | 789 | Open in IMG/M |
| 3300010399|Ga0134127_10926189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 928 | Open in IMG/M |
| 3300011000|Ga0138513_100006945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1324 | Open in IMG/M |
| 3300011400|Ga0137312_1054596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
| 3300012212|Ga0150985_120057420 | Not Available | 514 | Open in IMG/M |
| 3300012476|Ga0157344_1019005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300012895|Ga0157309_10324778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300012961|Ga0164302_11769894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 520 | Open in IMG/M |
| 3300012989|Ga0164305_10113369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1768 | Open in IMG/M |
| 3300013308|Ga0157375_11495470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 797 | Open in IMG/M |
| 3300014325|Ga0163163_10749876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1040 | Open in IMG/M |
| 3300014325|Ga0163163_12798676 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300015371|Ga0132258_11015381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
| 3300015372|Ga0132256_101156805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 888 | Open in IMG/M |
| 3300017965|Ga0190266_11004784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300018072|Ga0184635_10195240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
| 3300018075|Ga0184632_10081359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1414 | Open in IMG/M |
| 3300018081|Ga0184625_10202847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300018081|Ga0184625_10637968 | Not Available | 518 | Open in IMG/M |
| 3300018422|Ga0190265_10366030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1532 | Open in IMG/M |
| 3300018422|Ga0190265_10874125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1022 | Open in IMG/M |
| 3300018422|Ga0190265_11972212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300018422|Ga0190265_12824057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300018422|Ga0190265_12893705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300018422|Ga0190265_13566965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300018432|Ga0190275_12210224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. PA05 | 629 | Open in IMG/M |
| 3300018432|Ga0190275_13180957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300018469|Ga0190270_11671967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300018469|Ga0190270_12423194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300018469|Ga0190270_13155097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300018469|Ga0190270_13187538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300018476|Ga0190274_11229138 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300018476|Ga0190274_12281803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300018476|Ga0190274_12603582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli | 603 | Open in IMG/M |
| 3300018476|Ga0190274_12728323 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018481|Ga0190271_13601419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300018481|Ga0190271_13874108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300019875|Ga0193701_1092601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300020061|Ga0193716_1179642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 823 | Open in IMG/M |
| 3300021078|Ga0210381_10054735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1206 | Open in IMG/M |
| 3300022756|Ga0222622_11371310 | Not Available | 520 | Open in IMG/M |
| 3300022880|Ga0247792_1098727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300025559|Ga0210087_1116685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300025567|Ga0210076_1004022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3450 | Open in IMG/M |
| 3300025901|Ga0207688_10113164 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300025915|Ga0207693_10087791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2437 | Open in IMG/M |
| 3300025915|Ga0207693_10194076 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300025919|Ga0207657_11364661 | Not Available | 533 | Open in IMG/M |
| 3300025927|Ga0207687_11030673 | Not Available | 706 | Open in IMG/M |
| 3300025934|Ga0207686_11372758 | Not Available | 581 | Open in IMG/M |
| 3300025938|Ga0207704_10552651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 936 | Open in IMG/M |
| 3300025972|Ga0207668_12047509 | Not Available | 516 | Open in IMG/M |
| 3300025981|Ga0207640_10128867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1826 | Open in IMG/M |
| 3300026067|Ga0207678_10122498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 2219 | Open in IMG/M |
| 3300026088|Ga0207641_11973470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 585 | Open in IMG/M |
| 3300026089|Ga0207648_11608173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300027886|Ga0209486_11050296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
| 3300028589|Ga0247818_10932567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 611 | Open in IMG/M |
| 3300028717|Ga0307298_10117311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
| 3300028721|Ga0307315_10035081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1354 | Open in IMG/M |
| 3300028722|Ga0307319_10000784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9701 | Open in IMG/M |
| 3300028722|Ga0307319_10199730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300028722|Ga0307319_10226541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300028754|Ga0307297_10068605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300028784|Ga0307282_10330199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300028787|Ga0307323_10063473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
| 3300028790|Ga0307283_10058534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300028793|Ga0307299_10385115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300028796|Ga0307287_10356941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300028802|Ga0307503_10829747 | Not Available | 530 | Open in IMG/M |
| 3300028814|Ga0307302_10007449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4886 | Open in IMG/M |
| 3300028819|Ga0307296_10368820 | Not Available | 784 | Open in IMG/M |
| 3300028875|Ga0307289_10287179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300031908|Ga0310900_11693827 | Not Available | 536 | Open in IMG/M |
| 3300032075|Ga0310890_11179300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
| 3300033550|Ga0247829_10140857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1869 | Open in IMG/M |
| 3300033551|Ga0247830_10200391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1490 | Open in IMG/M |
| 3300033551|Ga0247830_10963819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300034114|Ga0364938_040894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 783 | Open in IMG/M |
| 3300034148|Ga0364927_0235579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 37.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_117721342 | 3300000890 | Soil | GQSTAWRPERPRLRLFPLVISWLGTGIALMVAAGLLPGVDIKSFWGALV |
| JGI24737J22298_102189331 | 3300001990 | Corn Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSIDS |
| Ga0062593_1024574832 | 3300004114 | Soil | MSSSPEQSYGRSSAWRPERPRLRVYPLFVSWLGTGIALMVAAGLLPGVDIKSF |
| Ga0063455_1004874561 | 3300004153 | Soil | MPSESDLDYGRSSWRPERPRWRLFPLVVSWLADGVAFIVAAG |
| Ga0062590_1026902241 | 3300004157 | Soil | MPSDPELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMVAAGVLPGVTIDNFWG |
| Ga0063356_1036261861 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPSESAPTHGQSTAWQPERPRLRLFPLLVSWFATGVALMVAAGILPGVHIDNFW |
| Ga0063356_1058617662 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTDDHAPTYGRSTSWQPERPRLRLFPLLVSWIATGVALMVA |
| Ga0062592_1013070412 | 3300004480 | Soil | MSSAAEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAA |
| Ga0062592_1017532651 | 3300004480 | Soil | MTSDSAQSYGQSMTWQPQRPRWRVFPLVVSWLGTGIALMVAAGVLPGVDIASFWGALLV |
| Ga0062594_1020344842 | 3300005093 | Soil | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGV |
| Ga0070658_119943321 | 3300005327 | Corn Rhizosphere | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVSIDSFWGA |
| Ga0070668_1002861473 | 3300005347 | Switchgrass Rhizosphere | MPSESELAYGQSTAWQPEPPRFRLFSLIVSWLAMGIALMVAAGLLPG |
| Ga0070700_1015459381 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLPGVSIESFLG |
| Ga0070686_1009363951 | 3300005544 | Switchgrass Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMV |
| Ga0070665_1015079242 | 3300005548 | Switchgrass Rhizosphere | VTSEAEPEYGQSMAWRPERPRFRLFPLLASWLATGV |
| Ga0068854_1021339382 | 3300005578 | Corn Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGV |
| Ga0068859_1006261371 | 3300005617 | Switchgrass Rhizosphere | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVSIDSF |
| Ga0068851_101069602 | 3300005834 | Corn Rhizosphere | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGV |
| Ga0075363_1002048532 | 3300006048 | Populus Endosphere | VASEAEPEYGQSTAWRPERPRFRLFPLLASWLATGV |
| Ga0074049_129386191 | 3300006580 | Soil | MSPMPDAPDRVYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAAGLLAGVD |
| Ga0075420_1003751122 | 3300006853 | Populus Rhizosphere | MTASEQATRTYGHSTAWRPERPTWRAFPLVVSWLATGIAL |
| Ga0097620_1030731001 | 3300006931 | Switchgrass Rhizosphere | MSSSSAQSYGQSTAWRPERPRLRLFPLVVSWLGTGIALMVAAGLLPGVDIKSF |
| Ga0105247_105169652 | 3300009101 | Switchgrass Rhizosphere | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAG |
| Ga0105104_109682562 | 3300009168 | Freshwater Sediment | MPSDHEQTYGHSTSWQPERARLKVFPLLVSWFATGV |
| Ga0105242_120038543 | 3300009176 | Miscanthus Rhizosphere | MPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLPGIA |
| Ga0105238_111807261 | 3300009551 | Corn Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAG |
| Ga0134127_109261892 | 3300010399 | Terrestrial Soil | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGLA |
| Ga0138513_1000069451 | 3300011000 | Soil | MPSDHEPTYGHSTSWQPERARLKVFPLLVSWFATGVALMVAAWALPGGLVRDAEALD |
| Ga0137312_10545962 | 3300011400 | Soil | MPSDNAPTYGQSTSWQPERPRLRLFPLIVSWLATGIA |
| Ga0150985_1200574202 | 3300012212 | Avena Fatua Rhizosphere | MPSQPELAYGESTAWKPEHPRWRVVPLVASWLGTGVALMTAAGLLPGVRI |
| Ga0157344_10190051 | 3300012476 | Arabidopsis Rhizosphere | MSSASEQSYGQSTAWRPERPRLRLFPLVISWLGTGIALM |
| Ga0157309_103247781 | 3300012895 | Soil | MPSDPELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMVAAGVLPGVTIDNFWGA |
| Ga0164302_117698941 | 3300012961 | Soil | MPSESGPDYGQSTAWRPERPRWRLFPLVASWLATGVALMVAAGLLPGVTI |
| Ga0164305_101133691 | 3300012989 | Soil | MPSESGPDYGHSTAWRPERPRFKLFPLVVSWLATGVALMVAAGILPGVSIDSFLGALL |
| Ga0157375_114954701 | 3300013308 | Miscanthus Rhizosphere | MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVRIDSFWGA |
| Ga0163163_107498763 | 3300014325 | Switchgrass Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATG |
| Ga0163163_127986763 | 3300014325 | Switchgrass Rhizosphere | MSSASEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALG |
| Ga0132258_110153811 | 3300015371 | Arabidopsis Rhizosphere | MASEAEPEYGQSTAWRPERPRFRLFPLVTSWLATGVALMVAAGLLPGVSIDSFWGAL |
| Ga0132256_1011568052 | 3300015372 | Arabidopsis Rhizosphere | MTNGPEPSYGHSVWRPERPRLRFFPLLVSWLATGVALMVAAGILPGV |
| Ga0190266_110047841 | 3300017965 | Soil | MTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVALMVASWA |
| Ga0184635_101952401 | 3300018072 | Groundwater Sediment | MPSEHEPTYGLSTSWQPERPRLRLFPLLVSWLATGVALMVAA |
| Ga0184632_100813592 | 3300018075 | Groundwater Sediment | MPSDKEPTYGHSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVD |
| Ga0184625_102028471 | 3300018081 | Groundwater Sediment | MTSDTEPSHTSSAAWQPERAHRRLFPLIVSWLATGVALMVAAWALPGVDIGTFWGAL |
| Ga0184625_106379681 | 3300018081 | Groundwater Sediment | MPNDHEPTYGLSTSWQPERPRLRLFPLLVSWFATGVALMVAAWALP |
| Ga0190265_103660303 | 3300018422 | Soil | MPSGSELKYGQSTDWRPERPRLRVFPLAVSWLAMGVALMVAAGVLPGVSIDNFFG |
| Ga0190265_108741251 | 3300018422 | Soil | MTSVPERSYGQSTAWKPERPQWRLFPLLVSWFATGVALM |
| Ga0190265_119722122 | 3300018422 | Soil | MMPSDSELTYGQSTNWQPERPRLRVFPLVVSWLAMGIALMVAAGI |
| Ga0190265_128240571 | 3300018422 | Soil | MPSDNEPTYGQSTSWQPERPRLRLFPLLVSWFATGVALMVAAW |
| Ga0190265_128937052 | 3300018422 | Soil | VPSDSEQTYGQSTEWQPERTRLRVFPLVVSWLAMGIALMVA |
| Ga0190265_135669652 | 3300018422 | Soil | MSSEPDPTDDRSTAWRAERVRWRVFPLLVSWLATGVAFMVAAGLL |
| Ga0190275_122102241 | 3300018432 | Soil | MPSDHEQTYGRSTSWQPERPRLKVFPLVISWFATGVALMVAA |
| Ga0190275_131809572 | 3300018432 | Soil | MTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVALMVASWALPGVDIVTFWGAL |
| Ga0190270_116719671 | 3300018469 | Soil | MTSSPERPYGQSTAWKPGAPRIRLFPLLVSWVATGVALMVAAWVLPG |
| Ga0190270_124231941 | 3300018469 | Soil | MTASAPPPVYGQSTAWRPERPRLRLFPLLVSWLGTGIALMVAAG |
| Ga0190270_131550972 | 3300018469 | Soil | MPSNSELTYGEATDWQPERPRWRVLPLVLSWLVMGIALMVAAGILPGVGIDNFWG |
| Ga0190270_131875382 | 3300018469 | Soil | MPSDHESTYGRSTSWQPERPRLRLFPLLISWLATGV |
| Ga0190274_112291381 | 3300018476 | Soil | MSSGHEPTYGHAWQPERPRLKVFPLVISWFATGVALMV |
| Ga0190274_122818031 | 3300018476 | Soil | MTSSDTERTYGQSTAWQPERARIRLFPLIVSWFATGVA |
| Ga0190274_126035821 | 3300018476 | Soil | MTTSDPQPTYGHSWRPERPRLKVFPLVVSWLATGIALMVASWLLPGVDIANFWGAL |
| Ga0190274_127283231 | 3300018476 | Soil | MPSDHEQTYGRSTSWQPERSRFRLFPLLVSWIATGVALMVAAWLLPGVDIKNFAGALGV |
| Ga0190271_136014191 | 3300018481 | Soil | MTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVA |
| Ga0190271_138741081 | 3300018481 | Soil | MSGDEKPTYGQSTAWKPERPRLRLVPLVISWLSTGIALM |
| Ga0193701_10926012 | 3300019875 | Soil | MPTDSELTYGESSAWKPERPRFTLFGLLVSWLATGVALMVAA |
| Ga0193716_11796422 | 3300020061 | Soil | MPSQTDPDYGQSTAWRPERPRWRVFPLVVSWLATGVALMVAAGLL |
| Ga0210381_100547351 | 3300021078 | Groundwater Sediment | MPSDKEPTYGHSTSWQPERPRFRLFPLLVSWIATGVALMVAA |
| Ga0222622_113713101 | 3300022756 | Groundwater Sediment | MTSNDEQTYGHSTSWQPERARLKVFPLLVSWISTGVALMVAAWILPGVDI |
| Ga0247792_10987271 | 3300022880 | Soil | MSSASEQTYGQSTAWRPERPRLRLFPLVVSWLGTGIALMV |
| Ga0210087_11166852 | 3300025559 | Natural And Restored Wetlands | MTRGDEQSYGRSMTWQPERPRWRLFPLVVSWLATGVALMVAAAL |
| Ga0210076_10040226 | 3300025567 | Natural And Restored Wetlands | MTRGDEQSYGQSMTWQPERPRWRLFPLVVSWFATGVALMVAAALLPGVDIA |
| Ga0207688_101131643 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSASEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAAG |
| Ga0207693_100877914 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSEPEPEYGKSTAWRAERPRFRLFPLVTSWLATGVALTVAAG |
| Ga0207693_101940763 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MASESEPEYGKSTAWRAERPRFRLFPLVTSWLATG |
| Ga0207657_113646611 | 3300025919 | Corn Rhizosphere | MPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLP |
| Ga0207687_110306732 | 3300025927 | Miscanthus Rhizosphere | MPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLPGV |
| Ga0207686_113727582 | 3300025934 | Miscanthus Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSIDSFWGALL |
| Ga0207704_105526513 | 3300025938 | Miscanthus Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGL |
| Ga0207668_120475091 | 3300025972 | Switchgrass Rhizosphere | MPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLPGIAIAG |
| Ga0207640_101288674 | 3300025981 | Corn Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLP |
| Ga0207678_101224981 | 3300026067 | Corn Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSI |
| Ga0207641_119734702 | 3300026088 | Switchgrass Rhizosphere | VTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLL |
| Ga0207648_116081732 | 3300026089 | Miscanthus Rhizosphere | MPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLP |
| Ga0209486_110502962 | 3300027886 | Agricultural Soil | MTRGPEPSYGQSTAWQPERPRWRLFPLLVSWFATGVALMVAAAIIR |
| Ga0247818_109325672 | 3300028589 | Soil | MPSQSEPDYGESTAWAPERPRWRVFPLLVSWLATGVALMVAAGLLPGVTIESFLGA |
| Ga0307298_101173111 | 3300028717 | Soil | MPDDQELTYGRSTSWQPERARFRLFPLLVSWIATGVALMAAAWLL |
| Ga0307315_100350813 | 3300028721 | Soil | MPSNSERTYGESTDWQPERPRFRVFPLVLSWLAMGIALMVAAGILPGVG |
| Ga0307319_100007841 | 3300028722 | Soil | MPNDHEPTYGLSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVDIRN |
| Ga0307319_101997302 | 3300028722 | Soil | MPSDSEPTYGQSTEWQPERPRLRVFPLVVSWLAMGIALMVA |
| Ga0307319_102265412 | 3300028722 | Soil | LPSDSELTYDQATDWHPERPRLRVFSLAVSWVAMGIALMVAALV |
| Ga0307297_100686052 | 3300028754 | Soil | MPSNYELTYGESTDWQPERPRFRVFPLVLSWLAMGIALMVAAGI |
| Ga0307282_103301992 | 3300028784 | Soil | MPSDSELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMAAA |
| Ga0307323_100634732 | 3300028787 | Soil | MPDDQELTYGRSTSWQPERARFRLFPLLVSWIATGVALMAAAWLLPGVDIKN |
| Ga0307283_100585341 | 3300028790 | Soil | MPSDSEPTYGESSAWKPERPRFTIFGLLVSWLATGVALMVAAGLLPG |
| Ga0307299_103851151 | 3300028793 | Soil | MPSNSELTYGQSTDWQPERPRFRVFPLVLSWLAMGIALMVAAGILPGVGIDNFWGA |
| Ga0307287_103569412 | 3300028796 | Soil | MPSNSERTYGESTDWQPERPRFRVFPLVLSWLAMG |
| Ga0307503_108297472 | 3300028802 | Soil | MPNESQLAYGQSTAWRPERPRIRVFPLLAGWLAMGVALMVAAGLLPGVWIDDFWGALVI |
| Ga0307302_100074491 | 3300028814 | Soil | MPSDQEPTYGRSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVDIR |
| Ga0307296_103688202 | 3300028819 | Soil | MTSDPEPSHSASAAWRPERARRRLFPLIVSWLATGVALMVAA |
| Ga0307289_102871791 | 3300028875 | Soil | MTSGPEPSYGQSTAWQPERPRLRPFPLLVSWLATGIAL |
| Ga0310900_116938272 | 3300031908 | Soil | MPSEAEPEYGQSTAWRPERPRFRLFPLLTSWLATGVALMVAAGLLPGVSIDSFWGAL |
| Ga0310890_111793002 | 3300032075 | Soil | MSSSSAQSYGQSTAWRPERPRLRLFPLVVSWLGTGIALMVAAGLLPGVDIK |
| Ga0247829_101408571 | 3300033550 | Soil | MPSETERIYGQSTHWKPERPRLRLIPLIVSWFATGVA |
| Ga0247830_102003912 | 3300033551 | Soil | MTTSEPERSYGHSTAWKPEAPRLRLFPLVVSWFATGVALMVAAWLLPGVDIRSF |
| Ga0247830_109638191 | 3300033551 | Soil | MTSEPAPEYGDSTAWSPERPRWRVFPLLVSWLATGVALMV |
| Ga0364938_040894_618_782 | 3300034114 | Sediment | MTSVPEPSYGQSTAWRPERPRWRLFPLLVSWFATGVALMVAAAILPGVDIESFWG |
| Ga0364927_0235579_437_544 | 3300034148 | Sediment | MSSDPEQTYGQSTDWQPERPRLRVFPLVVSWLAMAT |
| ⦗Top⦘ |