NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095430

Metagenome / Metatranscriptome Family F095430

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095430
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 46 residues
Representative Sequence MPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAG
Number of Associated Samples 84
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.10 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.29 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(37.143 % of family members)
Environment Ontology (ENVO) Unclassified
(38.095 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.381 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03706LPG_synthase_TM 17.14
PF07730HisKA_3 6.67
PF03631Virul_fac_BrkB 4.76
PF04020Phage_holin_4_2 4.76
PF06897DUF1269 2.86
PF01699Na_Ca_ex 1.90
PF07885Ion_trans_2 1.90
PF00196GerE 0.95
PF01266DAO 0.95
PF00581Rhodanese 0.95
PF13385Laminin_G_3 0.95
PF14023DUF4239 0.95
PF08402TOBE_2 0.95
PF13492GAF_3 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 17.14
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 6.67
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 6.67
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 6.67
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 6.67
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 4.76
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 4.76
COG4803Uncharacterized membrane proteinFunction unknown [S] 2.86
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 1.90
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 1.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.71 %
UnclassifiedrootN/A14.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11772134All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300001990|JGI24737J22298_10218933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter562Open in IMG/M
3300004114|Ga0062593_102457483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300004153|Ga0063455_100487456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300004157|Ga0062590_102690224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300004463|Ga0063356_103626186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300004463|Ga0063356_105861766All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium527Open in IMG/M
3300004480|Ga0062592_101307041All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium685Open in IMG/M
3300004480|Ga0062592_101753265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium606Open in IMG/M
3300005093|Ga0062594_102034484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli615Open in IMG/M
3300005327|Ga0070658_11994332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli501Open in IMG/M
3300005347|Ga0070668_100286147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1378Open in IMG/M
3300005441|Ga0070700_101545938Not Available565Open in IMG/M
3300005544|Ga0070686_100936395Not Available707Open in IMG/M
3300005548|Ga0070665_101507924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082681Open in IMG/M
3300005578|Ga0068854_102133938Not Available518Open in IMG/M
3300005617|Ga0068859_100626137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1168Open in IMG/M
3300005834|Ga0068851_10106960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821490Open in IMG/M
3300006048|Ga0075363_100204853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821128Open in IMG/M
3300006580|Ga0074049_12938619All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium753Open in IMG/M
3300006853|Ga0075420_100375112Not Available1231Open in IMG/M
3300006931|Ga0097620_103073100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300009101|Ga0105247_10516965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082872Open in IMG/M
3300009168|Ga0105104_10968256All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300009176|Ga0105242_12003854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300009551|Ga0105238_11180726Not Available789Open in IMG/M
3300010399|Ga0134127_10926189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082928Open in IMG/M
3300011000|Ga0138513_100006945All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1324Open in IMG/M
3300011400|Ga0137312_1054596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium667Open in IMG/M
3300012212|Ga0150985_120057420Not Available514Open in IMG/M
3300012476|Ga0157344_1019005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300012895|Ga0157309_10324778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300012961|Ga0164302_11769894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter520Open in IMG/M
3300012989|Ga0164305_10113369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1768Open in IMG/M
3300013308|Ga0157375_11495470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082797Open in IMG/M
3300014325|Ga0163163_10749876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821040Open in IMG/M
3300014325|Ga0163163_12798676All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300015371|Ga0132258_11015381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2096Open in IMG/M
3300015372|Ga0132256_101156805All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium888Open in IMG/M
3300017965|Ga0190266_11004784All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300018072|Ga0184635_10195240All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium807Open in IMG/M
3300018075|Ga0184632_10081359All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1414Open in IMG/M
3300018081|Ga0184625_10202847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300018081|Ga0184625_10637968Not Available518Open in IMG/M
3300018422|Ga0190265_10366030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1532Open in IMG/M
3300018422|Ga0190265_10874125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1022Open in IMG/M
3300018422|Ga0190265_11972212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300018422|Ga0190265_12824057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300018422|Ga0190265_12893705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300018422|Ga0190265_13566965All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300018432|Ga0190275_12210224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. PA05629Open in IMG/M
3300018432|Ga0190275_13180957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium531Open in IMG/M
3300018469|Ga0190270_11671967All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium690Open in IMG/M
3300018469|Ga0190270_12423194All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300018469|Ga0190270_13155097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300018469|Ga0190270_13187538All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300018476|Ga0190274_11229138All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300018476|Ga0190274_12281803All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium638Open in IMG/M
3300018476|Ga0190274_12603582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli603Open in IMG/M
3300018476|Ga0190274_12728323All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300018481|Ga0190271_13601419All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300018481|Ga0190271_13874108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300019875|Ga0193701_1092601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300020061|Ga0193716_1179642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684823Open in IMG/M
3300021078|Ga0210381_10054735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1206Open in IMG/M
3300022756|Ga0222622_11371310Not Available520Open in IMG/M
3300022880|Ga0247792_1098727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300025559|Ga0210087_1116685All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium518Open in IMG/M
3300025567|Ga0210076_1004022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3450Open in IMG/M
3300025901|Ga0207688_10113164All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300025915|Ga0207693_10087791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2437Open in IMG/M
3300025915|Ga0207693_10194076All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300025919|Ga0207657_11364661Not Available533Open in IMG/M
3300025927|Ga0207687_11030673Not Available706Open in IMG/M
3300025934|Ga0207686_11372758Not Available581Open in IMG/M
3300025938|Ga0207704_10552651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082936Open in IMG/M
3300025972|Ga0207668_12047509Not Available516Open in IMG/M
3300025981|Ga0207640_10128867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821826Open in IMG/M
3300026067|Ga0207678_10122498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli2219Open in IMG/M
3300026088|Ga0207641_11973470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082585Open in IMG/M
3300026089|Ga0207648_11608173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300027886|Ga0209486_11050296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium550Open in IMG/M
3300028589|Ga0247818_10932567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684611Open in IMG/M
3300028717|Ga0307298_10117311All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium762Open in IMG/M
3300028721|Ga0307315_10035081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1354Open in IMG/M
3300028722|Ga0307319_10000784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9701Open in IMG/M
3300028722|Ga0307319_10199730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300028722|Ga0307319_10226541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300028754|Ga0307297_10068605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1124Open in IMG/M
3300028784|Ga0307282_10330199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300028787|Ga0307323_10063473All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1309Open in IMG/M
3300028790|Ga0307283_10058534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300028793|Ga0307299_10385115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300028796|Ga0307287_10356941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300028802|Ga0307503_10829747Not Available530Open in IMG/M
3300028814|Ga0307302_10007449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter4886Open in IMG/M
3300028819|Ga0307296_10368820Not Available784Open in IMG/M
3300028875|Ga0307289_10287179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300031908|Ga0310900_11693827Not Available536Open in IMG/M
3300032075|Ga0310890_11179300All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium623Open in IMG/M
3300033550|Ga0247829_10140857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1869Open in IMG/M
3300033551|Ga0247830_10200391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1490Open in IMG/M
3300033551|Ga0247830_10963819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300034114|Ga0364938_040894All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium783Open in IMG/M
3300034148|Ga0364927_0235579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil37.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.90%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.90%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.95%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.95%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1177213423300000890SoilGQSTAWRPERPRLRLFPLVISWLGTGIALMVAAGLLPGVDIKSFWGALV
JGI24737J22298_1021893313300001990Corn RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSIDS
Ga0062593_10245748323300004114SoilMSSSPEQSYGRSSAWRPERPRLRVYPLFVSWLGTGIALMVAAGLLPGVDIKSF
Ga0063455_10048745613300004153SoilMPSESDLDYGRSSWRPERPRWRLFPLVVSWLADGVAFIVAAG
Ga0062590_10269022413300004157SoilMPSDPELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMVAAGVLPGVTIDNFWG
Ga0063356_10362618613300004463Arabidopsis Thaliana RhizosphereMPSESAPTHGQSTAWQPERPRLRLFPLLVSWFATGVALMVAAGILPGVHIDNFW
Ga0063356_10586176623300004463Arabidopsis Thaliana RhizosphereMTDDHAPTYGRSTSWQPERPRLRLFPLLVSWIATGVALMVA
Ga0062592_10130704123300004480SoilMSSAAEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAA
Ga0062592_10175326513300004480SoilMTSDSAQSYGQSMTWQPQRPRWRVFPLVVSWLGTGIALMVAAGVLPGVDIASFWGALLV
Ga0062594_10203448423300005093SoilVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGV
Ga0070658_1199433213300005327Corn RhizosphereMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVSIDSFWGA
Ga0070668_10028614733300005347Switchgrass RhizosphereMPSESELAYGQSTAWQPEPPRFRLFSLIVSWLAMGIALMVAAGLLPG
Ga0070700_10154593813300005441Corn, Switchgrass And Miscanthus RhizosphereMPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLPGVSIESFLG
Ga0070686_10093639513300005544Switchgrass RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMV
Ga0070665_10150792423300005548Switchgrass RhizosphereVTSEAEPEYGQSMAWRPERPRFRLFPLLASWLATGV
Ga0068854_10213393823300005578Corn RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGV
Ga0068859_10062613713300005617Switchgrass RhizosphereMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVSIDSF
Ga0068851_1010696023300005834Corn RhizosphereMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGV
Ga0075363_10020485323300006048Populus EndosphereVASEAEPEYGQSTAWRPERPRFRLFPLLASWLATGV
Ga0074049_1293861913300006580SoilMSPMPDAPDRVYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAAGLLAGVD
Ga0075420_10037511223300006853Populus RhizosphereMTASEQATRTYGHSTAWRPERPTWRAFPLVVSWLATGIAL
Ga0097620_10307310013300006931Switchgrass RhizosphereMSSSSAQSYGQSTAWRPERPRLRLFPLVVSWLGTGIALMVAAGLLPGVDIKSF
Ga0105247_1051696523300009101Switchgrass RhizosphereMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAG
Ga0105104_1096825623300009168Freshwater SedimentMPSDHEQTYGHSTSWQPERARLKVFPLLVSWFATGV
Ga0105242_1200385433300009176Miscanthus RhizosphereMPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLPGIA
Ga0105238_1118072613300009551Corn RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAG
Ga0134127_1092618923300010399Terrestrial SoilMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGLA
Ga0138513_10000694513300011000SoilMPSDHEPTYGHSTSWQPERARLKVFPLLVSWFATGVALMVAAWALPGGLVRDAEALD
Ga0137312_105459623300011400SoilMPSDNAPTYGQSTSWQPERPRLRLFPLIVSWLATGIA
Ga0150985_12005742023300012212Avena Fatua RhizosphereMPSQPELAYGESTAWKPEHPRWRVVPLVASWLGTGVALMTAAGLLPGVRI
Ga0157344_101900513300012476Arabidopsis RhizosphereMSSASEQSYGQSTAWRPERPRLRLFPLVISWLGTGIALM
Ga0157309_1032477813300012895SoilMPSDPELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMVAAGVLPGVTIDNFWGA
Ga0164302_1176989413300012961SoilMPSESGPDYGQSTAWRPERPRWRLFPLVASWLATGVALMVAAGLLPGVTI
Ga0164305_1011336913300012989SoilMPSESGPDYGHSTAWRPERPRFKLFPLVVSWLATGVALMVAAGILPGVSIDSFLGALL
Ga0157375_1149547013300013308Miscanthus RhizosphereMPSESEPEYGQSTAWRPERPRFRLFPLIASWLATGVALMVAAGVLPGVRIDSFWGA
Ga0163163_1074987633300014325Switchgrass RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATG
Ga0163163_1279867633300014325Switchgrass RhizosphereMSSASEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALG
Ga0132258_1101538113300015371Arabidopsis RhizosphereMASEAEPEYGQSTAWRPERPRFRLFPLVTSWLATGVALMVAAGLLPGVSIDSFWGAL
Ga0132256_10115680523300015372Arabidopsis RhizosphereMTNGPEPSYGHSVWRPERPRLRFFPLLVSWLATGVALMVAAGILPGV
Ga0190266_1100478413300017965SoilMTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVALMVASWA
Ga0184635_1019524013300018072Groundwater SedimentMPSEHEPTYGLSTSWQPERPRLRLFPLLVSWLATGVALMVAA
Ga0184632_1008135923300018075Groundwater SedimentMPSDKEPTYGHSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVD
Ga0184625_1020284713300018081Groundwater SedimentMTSDTEPSHTSSAAWQPERAHRRLFPLIVSWLATGVALMVAAWALPGVDIGTFWGAL
Ga0184625_1063796813300018081Groundwater SedimentMPNDHEPTYGLSTSWQPERPRLRLFPLLVSWFATGVALMVAAWALP
Ga0190265_1036603033300018422SoilMPSGSELKYGQSTDWRPERPRLRVFPLAVSWLAMGVALMVAAGVLPGVSIDNFFG
Ga0190265_1087412513300018422SoilMTSVPERSYGQSTAWKPERPQWRLFPLLVSWFATGVALM
Ga0190265_1197221223300018422SoilMMPSDSELTYGQSTNWQPERPRLRVFPLVVSWLAMGIALMVAAGI
Ga0190265_1282405713300018422SoilMPSDNEPTYGQSTSWQPERPRLRLFPLLVSWFATGVALMVAAW
Ga0190265_1289370523300018422SoilVPSDSEQTYGQSTEWQPERTRLRVFPLVVSWLAMGIALMVA
Ga0190265_1356696523300018422SoilMSSEPDPTDDRSTAWRAERVRWRVFPLLVSWLATGVAFMVAAGLL
Ga0190275_1221022413300018432SoilMPSDHEQTYGRSTSWQPERPRLKVFPLVISWFATGVALMVAA
Ga0190275_1318095723300018432SoilMTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVALMVASWALPGVDIVTFWGAL
Ga0190270_1167196713300018469SoilMTSSPERPYGQSTAWKPGAPRIRLFPLLVSWVATGVALMVAAWVLPG
Ga0190270_1242319413300018469SoilMTASAPPPVYGQSTAWRPERPRLRLFPLLVSWLGTGIALMVAAG
Ga0190270_1315509723300018469SoilMPSNSELTYGEATDWQPERPRWRVLPLVLSWLVMGIALMVAAGILPGVGIDNFWG
Ga0190270_1318753823300018469SoilMPSDHESTYGRSTSWQPERPRLRLFPLLISWLATGV
Ga0190274_1122913813300018476SoilMSSGHEPTYGHAWQPERPRLKVFPLVISWFATGVALMV
Ga0190274_1228180313300018476SoilMTSSDTERTYGQSTAWQPERARIRLFPLIVSWFATGVA
Ga0190274_1260358213300018476SoilMTTSDPQPTYGHSWRPERPRLKVFPLVVSWLATGIALMVASWLLPGVDIANFWGAL
Ga0190274_1272832313300018476SoilMPSDHEQTYGRSTSWQPERSRFRLFPLLVSWIATGVALMVAAWLLPGVDIKNFAGALGV
Ga0190271_1360141913300018481SoilMTSSDTERTYGHSTTWKPERARIRLFPLIVSWVATGVA
Ga0190271_1387410813300018481SoilMSGDEKPTYGQSTAWKPERPRLRLVPLVISWLSTGIALM
Ga0193701_109260123300019875SoilMPTDSELTYGESSAWKPERPRFTLFGLLVSWLATGVALMVAA
Ga0193716_117964223300020061SoilMPSQTDPDYGQSTAWRPERPRWRVFPLVVSWLATGVALMVAAGLL
Ga0210381_1005473513300021078Groundwater SedimentMPSDKEPTYGHSTSWQPERPRFRLFPLLVSWIATGVALMVAA
Ga0222622_1137131013300022756Groundwater SedimentMTSNDEQTYGHSTSWQPERARLKVFPLLVSWISTGVALMVAAWILPGVDI
Ga0247792_109872713300022880SoilMSSASEQTYGQSTAWRPERPRLRLFPLVVSWLGTGIALMV
Ga0210087_111668523300025559Natural And Restored WetlandsMTRGDEQSYGRSMTWQPERPRWRLFPLVVSWLATGVALMVAAAL
Ga0210076_100402263300025567Natural And Restored WetlandsMTRGDEQSYGQSMTWQPERPRWRLFPLVVSWFATGVALMVAAALLPGVDIA
Ga0207688_1011316433300025901Corn, Switchgrass And Miscanthus RhizosphereMSSASEKSYGQSTAWRPERPRLRLFPLVISWLGTGIALMVAAG
Ga0207693_1008779143300025915Corn, Switchgrass And Miscanthus RhizosphereMPSEPEPEYGKSTAWRAERPRFRLFPLVTSWLATGVALTVAAG
Ga0207693_1019407633300025915Corn, Switchgrass And Miscanthus RhizosphereMASESEPEYGKSTAWRAERPRFRLFPLVTSWLATG
Ga0207657_1136466113300025919Corn RhizosphereMPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLP
Ga0207687_1103067323300025927Miscanthus RhizosphereMPSESELAYGQSTAWQPEPPRFRLFSLVVSWLAMAAALMVAAGLLPGV
Ga0207686_1137275823300025934Miscanthus RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSIDSFWGALL
Ga0207704_1055265133300025938Miscanthus RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGL
Ga0207668_1204750913300025972Switchgrass RhizosphereMPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLPGIAIAG
Ga0207640_1012886743300025981Corn RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLP
Ga0207678_1012249813300026067Corn RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLLPGVSI
Ga0207641_1197347023300026088Switchgrass RhizosphereVTSEAEPEYGQSTAWRPERPRFRLFPLLASWLATGVALMVAAGLL
Ga0207648_1160817323300026089Miscanthus RhizosphereMPSESASASGPAADWRPERARRRLFPLIVSWLATGVALMVAAAVLP
Ga0209486_1105029623300027886Agricultural SoilMTRGPEPSYGQSTAWQPERPRWRLFPLLVSWFATGVALMVAAAIIR
Ga0247818_1093256723300028589SoilMPSQSEPDYGESTAWAPERPRWRVFPLLVSWLATGVALMVAAGLLPGVTIESFLGA
Ga0307298_1011731113300028717SoilMPDDQELTYGRSTSWQPERARFRLFPLLVSWIATGVALMAAAWLL
Ga0307315_1003508133300028721SoilMPSNSERTYGESTDWQPERPRFRVFPLVLSWLAMGIALMVAAGILPGVG
Ga0307319_1000078413300028722SoilMPNDHEPTYGLSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVDIRN
Ga0307319_1019973023300028722SoilMPSDSEPTYGQSTEWQPERPRLRVFPLVVSWLAMGIALMVA
Ga0307319_1022654123300028722SoilLPSDSELTYDQATDWHPERPRLRVFSLAVSWVAMGIALMVAALV
Ga0307297_1006860523300028754SoilMPSNYELTYGESTDWQPERPRFRVFPLVLSWLAMGIALMVAAGI
Ga0307282_1033019923300028784SoilMPSDSELTYGQSTDWQPERPRLRVFPLVVSWLAMGIALMAAA
Ga0307323_1006347323300028787SoilMPDDQELTYGRSTSWQPERARFRLFPLLVSWIATGVALMAAAWLLPGVDIKN
Ga0307283_1005853413300028790SoilMPSDSEPTYGESSAWKPERPRFTIFGLLVSWLATGVALMVAAGLLPG
Ga0307299_1038511513300028793SoilMPSNSELTYGQSTDWQPERPRFRVFPLVLSWLAMGIALMVAAGILPGVGIDNFWGA
Ga0307287_1035694123300028796SoilMPSNSERTYGESTDWQPERPRFRVFPLVLSWLAMG
Ga0307503_1082974723300028802SoilMPNESQLAYGQSTAWRPERPRIRVFPLLAGWLAMGVALMVAAGLLPGVWIDDFWGALVI
Ga0307302_1000744913300028814SoilMPSDQEPTYGRSTSWQPERPRLRLFPLLVSWIATGVALMVAAWALPGVDIR
Ga0307296_1036882023300028819SoilMTSDPEPSHSASAAWRPERARRRLFPLIVSWLATGVALMVAA
Ga0307289_1028717913300028875SoilMTSGPEPSYGQSTAWQPERPRLRPFPLLVSWLATGIAL
Ga0310900_1169382723300031908SoilMPSEAEPEYGQSTAWRPERPRFRLFPLLTSWLATGVALMVAAGLLPGVSIDSFWGAL
Ga0310890_1117930023300032075SoilMSSSSAQSYGQSTAWRPERPRLRLFPLVVSWLGTGIALMVAAGLLPGVDIK
Ga0247829_1014085713300033550SoilMPSETERIYGQSTHWKPERPRLRLIPLIVSWFATGVA
Ga0247830_1020039123300033551SoilMTTSEPERSYGHSTAWKPEAPRLRLFPLVVSWFATGVALMVAAWLLPGVDIRSF
Ga0247830_1096381913300033551SoilMTSEPAPEYGDSTAWSPERPRWRVFPLLVSWLATGVALMV
Ga0364938_040894_618_7823300034114SedimentMTSVPEPSYGQSTAWRPERPRWRLFPLLVSWFATGVALMVAAAILPGVDIESFWG
Ga0364927_0235579_437_5443300034148SedimentMSSDPEQTYGQSTDWQPERPRLRVFPLVVSWLAMAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.