NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095410

Metagenome Family F095410

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095410
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 87 residues
Representative Sequence MKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKV
Number of Associated Samples 66
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 43.81 %
% of genes near scaffold ends (potentially truncated) 49.52 %
% of genes from short scaffolds (< 2000 bps) 82.86 %
Associated GOLD sequencing projects 47
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (60.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(70.476 % of family members)
Environment Ontology (ENVO) Unclassified
(88.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.476 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 84.44%    β-sheet: 0.00%    Coil/Unstructured: 15.56%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF08291Peptidase_M15_3 25.71
PF13539Peptidase_M15_4 1.90
PF00149Metallophos 1.90
PF04865Baseplate_J 0.95
PF13455MUG113 0.95
PF02195ParBc 0.95
PF01510Amidase_2 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A60.00 %
All OrganismsrootAll Organisms40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10007701All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5987Open in IMG/M
3300000115|DelMOSum2011_c10080351All Organisms → Viruses → Predicted Viral1135Open in IMG/M
3300000115|DelMOSum2011_c10133723All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300000117|DelMOWin2010_c10006247Not Available7162Open in IMG/M
3300000117|DelMOWin2010_c10157014All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300000117|DelMOWin2010_c10158043Not Available740Open in IMG/M
3300000117|DelMOWin2010_c10238870All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300004097|Ga0055584_101642519All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006025|Ga0075474_10035132All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Heimdallarchaeota → Candidatus Heimdallarchaeota archaeon1745Open in IMG/M
3300006026|Ga0075478_10026153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1955Open in IMG/M
3300006026|Ga0075478_10097748Not Available938Open in IMG/M
3300006027|Ga0075462_10190935All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006637|Ga0075461_10052482All Organisms → Viruses → Predicted Viral1321Open in IMG/M
3300006637|Ga0075461_10197678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae603Open in IMG/M
3300006752|Ga0098048_1208903Not Available575Open in IMG/M
3300006802|Ga0070749_10696890Not Available543Open in IMG/M
3300006810|Ga0070754_10018694All Organisms → cellular organisms → Bacteria4106Open in IMG/M
3300006810|Ga0070754_10020258Not Available3899Open in IMG/M
3300006810|Ga0070754_10038289Not Available2620Open in IMG/M
3300006810|Ga0070754_10079982Not Available1650Open in IMG/M
3300006810|Ga0070754_10169080All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300006810|Ga0070754_10223837Not Available868Open in IMG/M
3300006810|Ga0070754_10226780Not Available861Open in IMG/M
3300006810|Ga0070754_10290779Not Available736Open in IMG/M
3300006810|Ga0070754_10345959All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006867|Ga0075476_10044691Not Available1808Open in IMG/M
3300006868|Ga0075481_10234623Not Available649Open in IMG/M
3300006869|Ga0075477_10416220Not Available521Open in IMG/M
3300006916|Ga0070750_10120757All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300006916|Ga0070750_10443570Not Available537Open in IMG/M
3300006919|Ga0070746_10042990All Organisms → Viruses → Predicted Viral2382Open in IMG/M
3300006919|Ga0070746_10166587Not Available1065Open in IMG/M
3300006919|Ga0070746_10219045Not Available899Open in IMG/M
3300007344|Ga0070745_1245343Not Available649Open in IMG/M
3300007345|Ga0070752_1047832Not Available1980Open in IMG/M
3300007345|Ga0070752_1060636Not Available1702Open in IMG/M
3300007345|Ga0070752_1172125Not Available878Open in IMG/M
3300007345|Ga0070752_1228295All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300007345|Ga0070752_1341299Not Available563Open in IMG/M
3300007346|Ga0070753_1134934Not Available943Open in IMG/M
3300007640|Ga0070751_1038542All Organisms → Viruses → Predicted Viral2151Open in IMG/M
3300007640|Ga0070751_1154566Not Available915Open in IMG/M
3300007640|Ga0070751_1167679Not Available869Open in IMG/M
3300007960|Ga0099850_1325036Not Available580Open in IMG/M
3300008012|Ga0075480_10168867Not Available1176Open in IMG/M
3300008012|Ga0075480_10238684Not Available945Open in IMG/M
3300010300|Ga0129351_1091437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1225Open in IMG/M
3300010368|Ga0129324_10234589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes735Open in IMG/M
3300010430|Ga0118733_104272909Not Available764Open in IMG/M
3300017726|Ga0181381_1016921Not Available1679Open in IMG/M
3300017769|Ga0187221_1044237Not Available1454Open in IMG/M
3300017770|Ga0187217_1041977Not Available1606Open in IMG/M
3300017813|Ga0188953_12419Not Available2094Open in IMG/M
3300017951|Ga0181577_10152494Not Available1571Open in IMG/M
3300019724|Ga0194003_1029164Not Available650Open in IMG/M
3300021335|Ga0213867_1086347Not Available1141Open in IMG/M
3300021356|Ga0213858_10049689Not Available2028Open in IMG/M
3300021425|Ga0213866_10021208Not Available3868Open in IMG/M
3300021425|Ga0213866_10304918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes798Open in IMG/M
3300022050|Ga0196883_1027116Not Available694Open in IMG/M
3300022067|Ga0196895_1020612Not Available733Open in IMG/M
3300022068|Ga0212021_1035987Not Available980Open in IMG/M
3300022068|Ga0212021_1121361Not Available535Open in IMG/M
3300022069|Ga0212026_1047870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes643Open in IMG/M
3300022069|Ga0212026_1061448Not Available569Open in IMG/M
3300022158|Ga0196897_1001640All Organisms → Viruses → Predicted Viral2858Open in IMG/M
3300022168|Ga0212027_1020820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae893Open in IMG/M
3300022187|Ga0196899_1028059All Organisms → Viruses → Predicted Viral1999Open in IMG/M
3300022187|Ga0196899_1040534All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Heimdallarchaeota → Candidatus Heimdallarchaeota archaeon1579Open in IMG/M
3300022187|Ga0196899_1122220All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300022187|Ga0196899_1144263Not Available667Open in IMG/M
3300022187|Ga0196899_1188281Not Available552Open in IMG/M
3300022200|Ga0196901_1214506Not Available612Open in IMG/M
(restricted) 3300024520|Ga0255047_10098613Not Available1501Open in IMG/M
3300025070|Ga0208667_1049241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes686Open in IMG/M
3300025084|Ga0208298_1056785Not Available756Open in IMG/M
3300025630|Ga0208004_1025755All Organisms → Viruses → Predicted Viral1774Open in IMG/M
3300025653|Ga0208428_1109128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae773Open in IMG/M
3300025671|Ga0208898_1080793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1046Open in IMG/M
3300025674|Ga0208162_1009596All Organisms → Viruses → Predicted Viral4139Open in IMG/M
3300025674|Ga0208162_1051347Not Available1384Open in IMG/M
3300025751|Ga0208150_1018795All Organisms → Viruses → Predicted Viral2449Open in IMG/M
3300025759|Ga0208899_1004258All Organisms → cellular organisms → Bacteria9072Open in IMG/M
3300025769|Ga0208767_1167987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae776Open in IMG/M
3300025771|Ga0208427_1043890Not Available1668Open in IMG/M
3300025810|Ga0208543_1047959All Organisms → Viruses → Predicted Viral1055Open in IMG/M
3300025810|Ga0208543_1055188Not Available975Open in IMG/M
3300025815|Ga0208785_1048543Not Available1196Open in IMG/M
3300025818|Ga0208542_1077374Not Available989Open in IMG/M
3300025828|Ga0208547_1060504All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300025853|Ga0208645_1023311Not Available3353Open in IMG/M
3300025853|Ga0208645_1046142Not Available2113Open in IMG/M
3300025853|Ga0208645_1096229Not Available1238Open in IMG/M
3300025853|Ga0208645_1116669Not Available1073Open in IMG/M
3300025853|Ga0208645_1120755All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300025889|Ga0208644_1088916Not Available1555Open in IMG/M
3300027917|Ga0209536_101482394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes826Open in IMG/M
3300029293|Ga0135211_1032358All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300029301|Ga0135222_1015547Not Available612Open in IMG/M
3300029448|Ga0183755_1001660All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp.12418Open in IMG/M
3300032136|Ga0316201_10919938Not Available737Open in IMG/M
3300032277|Ga0316202_10331082Not Available710Open in IMG/M
3300034374|Ga0348335_138998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes685Open in IMG/M
3300034418|Ga0348337_011405Not Available5081Open in IMG/M
3300034418|Ga0348337_057764Not Available1503Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous70.48%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine6.67%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.86%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.86%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.90%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.90%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.95%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.95%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.95%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.95%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.95%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.95%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.95%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.95%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.95%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017813Saline water viral communities from Saloum River inverse estuary, Senegal ? P2EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019724Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MGEnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300029301Marine harbor viral communities from the Indian Ocean - SRH1EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_10007701143300000115MarineMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWLSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
DelMOSum2011_1008035163300000115MarineMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
DelMOSum2011_1013372323300000115MarineMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
DelMOWin2010_1000624743300000117MarineMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKATP*
DelMOWin2010_1015701423300000117MarineMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
DelMOWin2010_1015804323300000117MarineMSLNELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
DelMOWin2010_1023887023300000117MarineMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0055584_10164251923300004097Pelagic MarineMKFDLGEWGINIGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTSFIVGFGGLKMVEAVYEKFINKATP*
Ga0075474_1003513213300006025AqueousFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYYKFFDKVTK*
Ga0075478_1002615343300006026AqueousMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKATS*
Ga0075478_1009774843300006026AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGL
Ga0075462_1019093523300006027AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0075461_1005248233300006637AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNK*
Ga0075461_1019767813300006637AqueousMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKAT
Ga0098048_120890323300006752MarineMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVSGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070749_1069689013300006802AqueousMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK*
Ga0070754_1001869443300006810AqueousMKFDLEELGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVAK*
Ga0070754_1002025833300006810AqueousMKFDLQELGINIGLMIGGFFGSLITIKKKRDFKEQFLSIVTGTMSANYLAPVLIDWMNLTGSSQYGTAFIVGFGGLKLVEAIYEKMFSKVNE*
Ga0070754_1003828913300006810AqueousQQSEKMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070754_1007998233300006810AqueousMKFDLEEIGINIGLMIGGFFGSLITIKKKRDLKEQFLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070754_1016908033300006810AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKMVEAFYDKFFNKIA*
Ga0070754_1022383743300006810AqueousLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0070754_1022678043300006810AqueousELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0070754_1029077923300006810AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGSGGLKMVEAFYHKFFDKVTK*
Ga0070754_1034595933300006810AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSIKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK*
Ga0075476_1004469113300006867AqueousFSRSQQSEKMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0075481_1023462313300006868AqueousRNLDVLMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0075477_1041622013300006869AqueousSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0070750_1012075723300006916AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIA*
Ga0070750_1044357013300006916AqueousNIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMSANYLSPVIIDYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNK*
Ga0070746_1004299073300006919AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK*
Ga0070746_1016658743300006919AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVIIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0070746_1021904533300006919AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRVLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070745_124534323300007344AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYYKFFDKVTK*
Ga0070752_104783213300007345AqueousMKFDLQELGINIGLMIGGFFGSLITIKKKRDFKEQFLSIVTGTMSANYLAPVLIDWMNLTGSSQYGTAFIVGFGGLKLVEAIYEKMFSKVNG*
Ga0070752_106063643300007345AqueousTGQMKFDLEELGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIEWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVAK*
Ga0070752_117212543300007345AqueousLMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0070752_122829523300007345AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSIKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNK*
Ga0070752_134129913300007345AqueousLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070753_113493413300007346AqueousLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070751_103854213300007640AqueousKMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0070751_115456613300007640AqueousNNNTLSINYKGKTKPQMKFDLQELGINIGLMIGGFFGSLITIKKKRDFKEQFLSIVTGTMSANYLAPVLIDWMNLTGSSQYGTAFIVGFGGLKLVEAVYEKMFSKVNE*
Ga0070751_116767913300007640AqueousLMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLPPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0099850_132503623300007960AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMSANYLSPVIIDYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG*
Ga0075480_1016886733300008012AqueousSRSQQSEKMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0075480_1023868413300008012AqueousKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK*
Ga0129351_109143733300010300Freshwater To Marine Saline GradientMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKV
Ga0129324_1023458913300010368Freshwater To Marine Saline GradientMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAF
Ga0118733_10427290913300010430Marine SedimentMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNK*
Ga0181381_101692153300017726SeawaterMNWNLSEIGINIGLMVGGFFGSLITIKKNRDLKEQLLSVVTGTMSANYLSPLIIDWFELTGSSQYGTAFIVGFGGLKMVEAIYDKFFKKI
Ga0187221_104423713300017769SeawaterMNWSLSEIGINIGLMVGGFFGSLITIKKNRDLKEQLLSVVTGTMSANYLSPLIIDWFELTGSSQYGTAFIVGFGGLKVVEAIYDKFFKKI
Ga0187217_104197733300017770SeawaterMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
Ga0188953_1241933300017813Saline WaterMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0181577_1015249443300017951Salt MarshMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0194003_102916423300019724SedimentMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKATP
Ga0213867_108634743300021335SeawaterMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0213858_1004968953300021356SeawaterMKFDLGEFGINIGLMIGGFFGSLITVKNKRSLKEQLLSVVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKATP
Ga0213866_1002120823300021425SeawaterMKFDLEELGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIEWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVAK
Ga0213866_1030491833300021425SeawaterMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVE
Ga0196883_102711643300022050AqueousFLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0196895_102061233300022067AqueousGGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0212021_103598743300022068AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEA
Ga0212021_112136123300022068AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVV
Ga0212026_104787023300022069AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKF
Ga0212026_106144813300022069AqueousGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0196897_100164033300022158AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTVTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0212027_102082013300022168AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFF
Ga0196899_102805943300022187AqueousMSLNELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKMVEAFYDKFFNKIA
Ga0196899_104053443300022187AqueousMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0196899_112222033300022187AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNK
Ga0196899_114426313300022187AqueousFFGSLITIKKKRSIKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
Ga0196899_118828123300022187AqueousGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0196901_121450633300022200AqueousIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
(restricted) Ga0255047_1009861323300024520SeawaterMKWNLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0208667_104924123300025070MarineMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVSGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDK
Ga0208298_105678523300025084MarineMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVSGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0208004_102575513300025630AqueousILMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
Ga0208428_110912823300025653AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKMVEAFYDKFFNKIA
Ga0208898_108079333300025671AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGL
Ga0208162_100959693300025674AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSVKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
Ga0208162_105134743300025674AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWLSLEGSSQYGTAFIVGFGGLKVV
Ga0208150_101879513300025751AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVE
Ga0208899_100425863300025759AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIA
Ga0208767_116798733300025769AqueousMSLNELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFF
Ga0208427_104389013300025771AqueousQQSEKMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0208543_104795953300025810AqueousGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0208543_105518813300025810AqueousMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAF
Ga0208785_104854313300025815AqueousFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYYKFFDKVTK
Ga0208542_107737443300025818AqueousVLMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0208547_106050413300025828AqueousLMSLSELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0208645_102331133300025853AqueousMKFDLQELGINIGLMIGGFFGSLITIKKKRDFKEQFLSIVTGTMSANYLAPVLIDWMNLTGSSQYGTAFIVGFGGLKLVEAIYEKMFSKVNE
Ga0208645_104614243300025853AqueousMKFDLEELGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVAK
Ga0208645_109622923300025853AqueousMKFDLEEIGINIGLMIGGFFGSLITIKKKRDLKEQFLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0208645_111666913300025853AqueousDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVITGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0208645_112075513300025853AqueousMSLNEIGINIGLMIGGFFGSLITIKKKRSIKEQLLSVVTGTMSANYLSPVIIEYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFSK
Ga0208644_108891633300025889AqueousMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKTTP
Ga0209536_10148239433300027917Marine SedimentMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYLSFEVPVV
Ga0135211_103235823300029293Marine HarborMSLNELGINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMAANYLSPVLIEWFNLTGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0135222_101554723300029301Marine HarborMKFDLGEFGINIGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYEKFINKATP
Ga0183755_1001660103300029448MarineMRFDLQELGINIGLMIGGFFGSLITIKKKRDLKEQFLSVITGTMSANYLAPILIDWMNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVSS
Ga0316201_1091993833300032136Worm BurrowLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYHKFFDKVTK
Ga0316202_1033108233300032277Microbial MatINIGLMIGGFFGSLITVKKKRCVKEQLLAVVTGTMSANYLSPVIIDYMSLEGSSQYGTAFIVGFGGLKVVEAFYDKFFNKIG
Ga0348335_138998_450_6833300034374AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKM
Ga0348337_011405_4447_47253300034418AqueousMKFDLDEIGINIGLMIGGFFGSLITIKKKRDLKEQLLSVVTGTMSANYLAPVLIDWLNLTGSSQYGTAFIVGFGGLKMVEAFYYKFFDKVTK
Ga0348337_057764_2_2533300034418AqueousMKFDLGEFGINVGLMIGGFFGSLITVKNKRSLKEQLLSIVTGTMSANYLAPVLIDWFNLTGSSQYGTAFIVGFGGLKMVEAVYE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.