| Basic Information | |
|---|---|
| Family ID | F095299 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.95 % |
| % of genes near scaffold ends (potentially truncated) | 40.95 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.619 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.59% β-sheet: 0.00% Coil/Unstructured: 55.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 5.71 |
| PF02311 | AraC_binding | 3.81 |
| PF00082 | Peptidase_S8 | 3.81 |
| PF00756 | Esterase | 2.86 |
| PF07676 | PD40 | 2.86 |
| PF07366 | SnoaL | 2.86 |
| PF00326 | Peptidase_S9 | 1.90 |
| PF07732 | Cu-oxidase_3 | 1.90 |
| PF01068 | DNA_ligase_A_M | 1.90 |
| PF04679 | DNA_ligase_A_C | 1.90 |
| PF03992 | ABM | 1.90 |
| PF13335 | Mg_chelatase_C | 0.95 |
| PF12697 | Abhydrolase_6 | 0.95 |
| PF01548 | DEDD_Tnp_IS110 | 0.95 |
| PF02810 | SEC-C | 0.95 |
| PF00069 | Pkinase | 0.95 |
| PF13683 | rve_3 | 0.95 |
| PF12544 | LAM_C | 0.95 |
| PF14534 | DUF4440 | 0.95 |
| PF13738 | Pyr_redox_3 | 0.95 |
| PF01479 | S4 | 0.95 |
| PF01566 | Nramp | 0.95 |
| PF00266 | Aminotran_5 | 0.95 |
| PF10647 | Gmad1 | 0.95 |
| PF00400 | WD40 | 0.95 |
| PF01520 | Amidase_3 | 0.95 |
| PF04471 | Mrr_cat | 0.95 |
| PF13191 | AAA_16 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 3.81 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.90 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.90 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.43 % |
| Unclassified | root | N/A | 48.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_112262383 | Not Available | 1223 | Open in IMG/M |
| 3300000956|JGI10216J12902_118616461 | Not Available | 630 | Open in IMG/M |
| 3300004114|Ga0062593_100043911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 2713 | Open in IMG/M |
| 3300004114|Ga0062593_100088120 | Not Available | 2134 | Open in IMG/M |
| 3300004156|Ga0062589_100999871 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300004480|Ga0062592_100006407 | Not Available | 4279 | Open in IMG/M |
| 3300004480|Ga0062592_100874957 | Not Available | 806 | Open in IMG/M |
| 3300005093|Ga0062594_102117239 | Not Available | 605 | Open in IMG/M |
| 3300005093|Ga0062594_103047591 | Not Available | 523 | Open in IMG/M |
| 3300005328|Ga0070676_10535697 | Not Available | 836 | Open in IMG/M |
| 3300005329|Ga0070683_100073367 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300005329|Ga0070683_102210604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300005331|Ga0070670_100021603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5535 | Open in IMG/M |
| 3300005338|Ga0068868_100843320 | Not Available | 830 | Open in IMG/M |
| 3300005339|Ga0070660_101066984 | Not Available | 683 | Open in IMG/M |
| 3300005341|Ga0070691_10454271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Emcibacterales → Emcibacteraceae → Paremcibacter → Paremcibacter congregatus | 732 | Open in IMG/M |
| 3300005344|Ga0070661_100203195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1515 | Open in IMG/M |
| 3300005353|Ga0070669_100166222 | Not Available | 1717 | Open in IMG/M |
| 3300005354|Ga0070675_100711439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300005355|Ga0070671_100110764 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300005365|Ga0070688_100231184 | Not Available | 1308 | Open in IMG/M |
| 3300005366|Ga0070659_100170367 | Not Available | 1783 | Open in IMG/M |
| 3300005367|Ga0070667_102140756 | Not Available | 527 | Open in IMG/M |
| 3300005440|Ga0070705_101887588 | Not Available | 508 | Open in IMG/M |
| 3300005444|Ga0070694_101488629 | Not Available | 573 | Open in IMG/M |
| 3300005535|Ga0070684_100133322 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300005616|Ga0068852_101196052 | Not Available | 781 | Open in IMG/M |
| 3300005618|Ga0068864_100094422 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300005718|Ga0068866_10312940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 985 | Open in IMG/M |
| 3300005764|Ga0066903_107313577 | Not Available | 571 | Open in IMG/M |
| 3300005834|Ga0068851_10981060 | Not Available | 532 | Open in IMG/M |
| 3300005841|Ga0068863_102096274 | Not Available | 575 | Open in IMG/M |
| 3300005841|Ga0068863_102540747 | Not Available | 521 | Open in IMG/M |
| 3300006755|Ga0079222_10511275 | Not Available | 884 | Open in IMG/M |
| 3300006804|Ga0079221_10726592 | Not Available | 697 | Open in IMG/M |
| 3300006845|Ga0075421_100600273 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300006847|Ga0075431_100061621 | All Organisms → cellular organisms → Bacteria | 3871 | Open in IMG/M |
| 3300006871|Ga0075434_100666053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1059 | Open in IMG/M |
| 3300009098|Ga0105245_10860120 | Not Available | 947 | Open in IMG/M |
| 3300009100|Ga0075418_10022931 | All Organisms → cellular organisms → Bacteria | 6853 | Open in IMG/M |
| 3300009100|Ga0075418_10370560 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300009148|Ga0105243_11928314 | Not Available | 624 | Open in IMG/M |
| 3300009156|Ga0111538_10132549 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300009174|Ga0105241_11880582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300009176|Ga0105242_10159073 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300009177|Ga0105248_11599683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma endbachense | 738 | Open in IMG/M |
| 3300009551|Ga0105238_10280306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1648 | Open in IMG/M |
| 3300009551|Ga0105238_11422617 | Not Available | 721 | Open in IMG/M |
| 3300009553|Ga0105249_10301216 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300009553|Ga0105249_10671206 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300010397|Ga0134124_11509967 | Not Available | 700 | Open in IMG/M |
| 3300011000|Ga0138513_100081005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300011119|Ga0105246_12593050 | Not Available | 501 | Open in IMG/M |
| 3300012212|Ga0150985_109526631 | Not Available | 2193 | Open in IMG/M |
| 3300012955|Ga0164298_10601761 | Not Available | 755 | Open in IMG/M |
| 3300012958|Ga0164299_10707555 | Not Available | 705 | Open in IMG/M |
| 3300012960|Ga0164301_10793930 | Not Available | 723 | Open in IMG/M |
| 3300012985|Ga0164308_11595593 | Not Available | 602 | Open in IMG/M |
| 3300012986|Ga0164304_10235766 | Not Available | 1218 | Open in IMG/M |
| 3300012988|Ga0164306_11297411 | Not Available | 615 | Open in IMG/M |
| 3300012989|Ga0164305_10067478 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300013102|Ga0157371_10264350 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300013296|Ga0157374_10772607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 976 | Open in IMG/M |
| 3300013297|Ga0157378_10240846 | Not Available | 1728 | Open in IMG/M |
| 3300013306|Ga0163162_11546479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 756 | Open in IMG/M |
| 3300014325|Ga0163163_12703244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 553 | Open in IMG/M |
| 3300014745|Ga0157377_10086383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1843 | Open in IMG/M |
| 3300015265|Ga0182005_1133113 | Not Available | 714 | Open in IMG/M |
| 3300015371|Ga0132258_10070085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 8129 | Open in IMG/M |
| 3300015371|Ga0132258_11527228 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300015371|Ga0132258_12647366 | Not Available | 1252 | Open in IMG/M |
| 3300015372|Ga0132256_100025049 | All Organisms → cellular organisms → Bacteria | 5339 | Open in IMG/M |
| 3300015372|Ga0132256_101009889 | Not Available | 947 | Open in IMG/M |
| 3300015374|Ga0132255_102040873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 873 | Open in IMG/M |
| 3300015374|Ga0132255_105240518 | Not Available | 549 | Open in IMG/M |
| 3300022899|Ga0247795_1075361 | Not Available | 585 | Open in IMG/M |
| 3300025899|Ga0207642_10332509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 891 | Open in IMG/M |
| 3300025919|Ga0207657_10155780 | Not Available | 1858 | Open in IMG/M |
| 3300025919|Ga0207657_10408561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300025920|Ga0207649_11049398 | Not Available | 642 | Open in IMG/M |
| 3300025923|Ga0207681_10713264 | Not Available | 834 | Open in IMG/M |
| 3300025925|Ga0207650_10044091 | All Organisms → cellular organisms → Bacteria | 3277 | Open in IMG/M |
| 3300025930|Ga0207701_10000029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 110107 | Open in IMG/M |
| 3300025933|Ga0207706_10025320 | All Organisms → cellular organisms → Bacteria | 5317 | Open in IMG/M |
| 3300025936|Ga0207670_11639237 | Not Available | 547 | Open in IMG/M |
| 3300025940|Ga0207691_10029589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5123 | Open in IMG/M |
| 3300025944|Ga0207661_10073381 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
| 3300025944|Ga0207661_10264330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1534 | Open in IMG/M |
| 3300026075|Ga0207708_10402025 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300026078|Ga0207702_10315533 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300026078|Ga0207702_10900635 | Not Available | 876 | Open in IMG/M |
| 3300026088|Ga0207641_10263233 | Not Available | 1616 | Open in IMG/M |
| 3300026095|Ga0207676_10091899 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300026116|Ga0207674_10593363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1070 | Open in IMG/M |
| 3300026142|Ga0207698_10876186 | Not Available | 904 | Open in IMG/M |
| 3300027909|Ga0209382_10290643 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300028380|Ga0268265_11863383 | Not Available | 608 | Open in IMG/M |
| 3300028381|Ga0268264_11466375 | Not Available | 693 | Open in IMG/M |
| 3300031538|Ga0310888_10066086 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300031716|Ga0310813_10389782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1196 | Open in IMG/M |
| 3300031892|Ga0310893_10126720 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031908|Ga0310900_10087607 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1959 | Open in IMG/M |
| 3300031908|Ga0310900_11499051 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300032013|Ga0310906_11008461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300032075|Ga0310890_11792352 | Not Available | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1122623831 | 3300000956 | Soil | KFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| JGI10216J12902_1186164611 | 3300000956 | Soil | VGTMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP* |
| Ga0062593_1000439113 | 3300004114 | Soil | MNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVLTCPERP* |
| Ga0062593_1000881202 | 3300004114 | Soil | MVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP* |
| Ga0062589_1009998712 | 3300004156 | Soil | VVECWCLMVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP* |
| Ga0062592_1000064071 | 3300004480 | Soil | MVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLAC |
| Ga0062592_1008749571 | 3300004480 | Soil | VVECWCLMVETMNRVRLDTCETCRKFEAKDLEPLKWAIIRRRRVLAIQLLP* |
| Ga0062594_1021172392 | 3300005093 | Soil | LMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP* |
| Ga0062594_1030475911 | 3300005093 | Soil | LMVETMNRVRLDRFTRETWRKFDAKDLEPFKWAILGRRRVLAMQLP* |
| Ga0070676_105356972 | 3300005328 | Miscanthus Rhizosphere | ERMNRLTLDRFTRDIWRTFDATDLEPLKWAILRRRRVLAMQLRP* |
| Ga0070683_1000733671 | 3300005329 | Corn Rhizosphere | DSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0070683_1022106042 | 3300005329 | Corn Rhizosphere | MVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAV |
| Ga0070670_1000216033 | 3300005331 | Switchgrass Rhizosphere | VVVECWCLMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0068868_1008433201 | 3300005338 | Miscanthus Rhizosphere | FTRETWRKFDPADLEPLKAAILRRRRVLAAPVRMLPVATLR* |
| Ga0070660_1010669842 | 3300005339 | Corn Rhizosphere | KTMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP* |
| Ga0070691_104542712 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MVETMNRVRLDRFTRETWKKFDAKDLEPLEWVIIRRRRVPAMQLRP* |
| Ga0070661_1002031952 | 3300005344 | Corn Rhizosphere | VVECWCLMVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAVGCPVRP* |
| Ga0070669_1001662221 | 3300005353 | Switchgrass Rhizosphere | MVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP* |
| Ga0070675_1007114391 | 3300005354 | Miscanthus Rhizosphere | MVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0070671_1001107643 | 3300005355 | Switchgrass Rhizosphere | MTTKSPAPPVVVECWCLMVATMNRVRLDKFTRETWKKFDAKDPEPLKWAILRRRRVLACPVRP* |
| Ga0070688_1002311841 | 3300005365 | Switchgrass Rhizosphere | CLMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP* |
| Ga0070659_1001703673 | 3300005366 | Corn Rhizosphere | MVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP* |
| Ga0070667_1021407561 | 3300005367 | Switchgrass Rhizosphere | VVVECWCLMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP* |
| Ga0070705_1018875881 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MVADMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALQAWP* |
| Ga0070694_1014886292 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVPTCPERP* |
| Ga0070684_1001333221 | 3300005535 | Corn Rhizosphere | VVECWCLMVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0068852_1011960522 | 3300005616 | Corn Rhizosphere | RVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP* |
| Ga0068864_1000944223 | 3300005618 | Switchgrass Rhizosphere | VRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0068866_103129401 | 3300005718 | Miscanthus Rhizosphere | MVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP* |
| Ga0066903_1073135772 | 3300005764 | Tropical Forest Soil | VATIGFGCWCLMVETTNRVRLDKFTRETWRKFDAKDLEPLKWAIIRRRRVLAFQAWP* |
| Ga0068851_109810601 | 3300005834 | Corn Rhizosphere | MVETMDRVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP* |
| Ga0068863_1020962742 | 3300005841 | Switchgrass Rhizosphere | MVATMDRVRLDRFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP* |
| Ga0068863_1025407471 | 3300005841 | Switchgrass Rhizosphere | MVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPV |
| Ga0079222_105112751 | 3300006755 | Agricultural Soil | MNRVRLDKFTRETWRKFDAKDLEPLEWAILRGRRVLAMQLRP* |
| Ga0079221_107265921 | 3300006804 | Agricultural Soil | VECWVLMVASMDRLTLDQFTRRIWRKFDPKDLEPLKWAILRRRRLLSCAMRP* |
| Ga0075421_1006002733 | 3300006845 | Populus Rhizosphere | VVECWCLMVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP* |
| Ga0075431_1000616213 | 3300006847 | Populus Rhizosphere | MVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP* |
| Ga0075434_1006660531 | 3300006871 | Populus Rhizosphere | LILMVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP* |
| Ga0105245_108601201 | 3300009098 | Miscanthus Rhizosphere | MVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRVLAMQLRP* |
| Ga0075418_1002293110 | 3300009100 | Populus Rhizosphere | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRILAMQLWP* |
| Ga0075418_103705601 | 3300009100 | Populus Rhizosphere | MVEAMDRVRLDKFTRETWRKFDAKDFEPLKWAILRRRRVLAMRPWP* |
| Ga0105243_119283141 | 3300009148 | Miscanthus Rhizosphere | WCLMVGTMDRVRLDKFTRETWRKFDAKDLEPLKWAILRRRRVLACPVRP* |
| Ga0111538_101325493 | 3300009156 | Populus Rhizosphere | MVEAMDRVRLDKFTRETWRKFDVKDFEPLKWAILRRRRVLAMRPWP* |
| Ga0105241_118805821 | 3300009174 | Corn Rhizosphere | MVATMDRVRLDRFTRETWKTFDAKDLEPLKWVILRRRRVLAAPMRP* |
| Ga0105242_101590731 | 3300009176 | Miscanthus Rhizosphere | MVATMDGVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP* |
| Ga0105248_115996832 | 3300009177 | Switchgrass Rhizosphere | MVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP* |
| Ga0105238_102803062 | 3300009551 | Corn Rhizosphere | VVECGILMVGTMDRVRLDRFTRETWRKFDAKDLEPLKATILERRRALAAPVRP* |
| Ga0105238_114226172 | 3300009551 | Corn Rhizosphere | MVATMDRVRLDKFTRDTWKKFDTKDLETLKWAIILRRRMLACSSAR* |
| Ga0105249_103012162 | 3300009553 | Switchgrass Rhizosphere | MVETMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRLLALQLRP* |
| Ga0105249_106712063 | 3300009553 | Switchgrass Rhizosphere | MNRVRLDKFTPETWGKFDAKDLEPVKRAIIRKRRVLA* |
| Ga0134124_115099671 | 3300010397 | Terrestrial Soil | MVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRILACPMRP* |
| Ga0138513_1000810052 | 3300011000 | Soil | MVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQAWP* |
| Ga0105246_125930502 | 3300011119 | Miscanthus Rhizosphere | RLDKFTRETWKKFDAKDLEPLKAAILRRRQVLAAPVRT* |
| Ga0150985_1095266313 | 3300012212 | Avena Fatua Rhizosphere | MVETMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARQLRP* |
| Ga0164298_106017611 | 3300012955 | Soil | PPIVIECWCLMVATMNRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP* |
| Ga0164299_107075553 | 3300012958 | Soil | MVETMNRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLTMQLWP* |
| Ga0164301_107939301 | 3300012960 | Soil | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP* |
| Ga0164308_115955931 | 3300012985 | Soil | MVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLTMQLWP* |
| Ga0164304_102357663 | 3300012986 | Soil | MVATMDRVRLDRFTRETRRKFDAKDLEPLKWAILRRRRVLAMQLWP* |
| Ga0164306_112974111 | 3300012988 | Soil | ILMVAMMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLARPAWP* |
| Ga0164305_100674782 | 3300012989 | Soil | MVETMNRVRLDKFTRESWKNFDAKDLEPLKWAILRRRRVLTMQLWP* |
| Ga0157371_102643502 | 3300013102 | Corn Rhizosphere | VVEHWCLMVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP* |
| Ga0157374_107726072 | 3300013296 | Miscanthus Rhizosphere | WCLMVPAMDRVRLDKFTRETWRKFAPADLEPLKAAILRRRRVLAAPVRMLPVATLR* |
| Ga0157378_102408462 | 3300013297 | Miscanthus Rhizosphere | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALHAWP* |
| Ga0163162_115464792 | 3300013306 | Switchgrass Rhizosphere | MVATRTRVRLDRFTRDTWRKFDAQDLEPLKWAIIPRRRILAMQAASPP* |
| Ga0163163_127032442 | 3300014325 | Switchgrass Rhizosphere | DRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP* |
| Ga0157377_100863832 | 3300014745 | Miscanthus Rhizosphere | MDRVRLDRFTRETWRKFDEKDLEPLKAASIRRRRVLACPVRP* |
| Ga0182005_11331131 | 3300015265 | Rhizosphere | MVATSDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP* |
| Ga0132258_100700851 | 3300015371 | Arabidopsis Rhizosphere | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRLLARQAWP* |
| Ga0132258_115272283 | 3300015371 | Arabidopsis Rhizosphere | MVERMGRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRALACPVRP* |
| Ga0132258_126473663 | 3300015371 | Arabidopsis Rhizosphere | MVETMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAMQLRP* |
| Ga0132256_1000250494 | 3300015372 | Arabidopsis Rhizosphere | MVATMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRVLARQAWP* |
| Ga0132256_1010098892 | 3300015372 | Arabidopsis Rhizosphere | VVVECFILMVATMDRARLDRFTRRTWRKHDARDLEPLKWAILRRRRLLAMQLWP* |
| Ga0132255_1020408731 | 3300015374 | Arabidopsis Rhizosphere | WISMVADMDRVRLDRFARETWKKFDAKDLEPLKWAILRRRRVLAAPMRP* |
| Ga0132255_1052405181 | 3300015374 | Arabidopsis Rhizosphere | DRVRLDKFTREMWKKFDARDLEPLEWAIIRRRRILAMQLRP* |
| Ga0247795_10753612 | 3300022899 | Soil | MVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP |
| Ga0207642_103325091 | 3300025899 | Miscanthus Rhizosphere | MVATMDRVRLDRFTRETWRKFDAKDLEPLKWAILRRRRVLAMQLWP |
| Ga0207657_101557802 | 3300025919 | Corn Rhizosphere | MVATMDRVRLDRFTRETWRKFDETDLEPLKAAILRRRRTLAAPVKP |
| Ga0207657_104085612 | 3300025919 | Corn Rhizosphere | MVETMNRVRLDRFTRETWPKFDGKDPEPLKAAFLRRRRVLAAPVRP |
| Ga0207649_110493981 | 3300025920 | Corn Rhizosphere | ILMVETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP |
| Ga0207681_107132641 | 3300025923 | Switchgrass Rhizosphere | VETMDRVRLDRFTRETWRKFDEKDLEPLKAAIIRRRRVLACPVRP |
| Ga0207650_100440913 | 3300025925 | Switchgrass Rhizosphere | MVATRDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP |
| Ga0207701_100000298 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRVRLDRFTRETRCKLDAKDLAPQKRAIIRRRPVLTCPERP |
| Ga0207706_100253203 | 3300025933 | Corn Rhizosphere | MNRVRLDKFAPETWGKFDAKDLEPVKRAIIRRRRVLA |
| Ga0207670_116392372 | 3300025936 | Switchgrass Rhizosphere | MVETMDRVRLDSFTRETWKKFDAKDLEPLKWAILRRRRVLACPMRP |
| Ga0207691_100295892 | 3300025940 | Miscanthus Rhizosphere | MVATMDRVRLDKFTRGTWKKFDAKDLEPLKWAIIRRRRTLAMQLRP |
| Ga0207661_100733811 | 3300025944 | Corn Rhizosphere | DSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP |
| Ga0207661_102643301 | 3300025944 | Corn Rhizosphere | MDRVRLDKFTRETWRKFDPADLEPLKAAILRHRRVLAAPVRMLPVATLR |
| Ga0207708_104020252 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVETMNRVRLDRFTRETWRKFDAKDLELFKWAILRRRRVLAMQLP |
| Ga0207702_103155331 | 3300026078 | Corn Rhizosphere | MVATMDHVRLDRFTRETWKKFDAKDLEPLKWAILRRRRALTMQL |
| Ga0207702_109006351 | 3300026078 | Corn Rhizosphere | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLALHAWP |
| Ga0207641_102632331 | 3300026088 | Switchgrass Rhizosphere | MVPAMDRVRLDKFTRETWRKFDPADLEPLKAAILRHRRVLAAPVRMLPVAT |
| Ga0207676_100918993 | 3300026095 | Switchgrass Rhizosphere | PAPPVVVECWCLMVATSDSVRLDKFTRETWKKFDAKDLETLKWAILGRRRVLACPVRP |
| Ga0207674_105933632 | 3300026116 | Corn Rhizosphere | MVATMDRVRLDRFTRETWRKFDEKDLEPLKWAIILRWRAVGCPVRP |
| Ga0207698_108761863 | 3300026142 | Corn Rhizosphere | PPVVVECWCLLVETMDRVRLDRFTRETWRKFHAKDLEPLKAAIIRRRRVLAMQLRP |
| Ga0209382_102906432 | 3300027909 | Populus Rhizosphere | MVEAMDRVRLDKFTRETWRKFDAKGFEPLKWAILRRRRVLAMRPWP |
| Ga0268265_118633832 | 3300028380 | Switchgrass Rhizosphere | NRVRLDRFTRETWRKFDAKDLEPFKWAILGRRRVLAMQLP |
| Ga0268264_114663752 | 3300028381 | Switchgrass Rhizosphere | AIMDRVRLDKFTRETWKKFDAKDLEPLKAAILRRRRLLALQLRP |
| Ga0310888_100660861 | 3300031538 | Soil | MVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLACPMRP |
| Ga0310813_103897822 | 3300031716 | Soil | MVPAMDRVRLDKFTRETWRKFDPADLEPLKAAILRRRRVLAAPVRMLPVATLR |
| Ga0310893_101267202 | 3300031892 | Soil | LMVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLACPMRP |
| Ga0310900_100876071 | 3300031908 | Soil | MVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRILACPMRP |
| Ga0310900_114990511 | 3300031908 | Soil | MVATMDRVRLDKFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP |
| Ga0310906_110084612 | 3300032013 | Soil | MVADMDRVRLDRFTRETWKKFDAKDLEPLKWAILRRRRVLAAPMRP |
| Ga0310890_117923521 | 3300032075 | Soil | MVATMDRVRLDKFTRETWRKFDPADLEPQKWAIILRRRTLA |
| ⦗Top⦘ |