NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095293

Metagenome / Metatranscriptome Family F095293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095293
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 44 residues
Representative Sequence KAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ
Number of Associated Samples 84
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.81 %
% of genes near scaffold ends (potentially truncated) 91.43 %
% of genes from short scaffolds (< 2000 bps) 92.38 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.238 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.89%    β-sheet: 0.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03401TctC 20.00
PF00753Lactamase_B 5.71
PF04073tRNA_edit 3.81
PF13505OMP_b-brl 2.86
PF04392ABC_sub_bind 1.90
PF13545HTH_Crp_2 1.90
PF07883Cupin_2 1.90
PF13343SBP_bac_6 1.90
PF07690MFS_1 0.95
PF01548DEDD_Tnp_IS110 0.95
PF04828GFA 0.95
PF01135PCMT 0.95
PF00144Beta-lactamase 0.95
PF00355Rieske 0.95
PF00211Guanylate_cyc 0.95
PF01717Meth_synt_2 0.95
PF00975Thioesterase 0.95
PF07045DUF1330 0.95
PF07992Pyr_redox_2 0.95
PF03047ComC 0.95
PF13602ADH_zinc_N_2 0.95
PF00903Glyoxalase 0.95
PF05598DUF772 0.95
PF00353HemolysinCabind 0.95
PF13489Methyltransf_23 0.95
PF00756Esterase 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 20.00
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.90
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.95
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.95
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.95
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.95
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.95
COG2367Beta-lactamase class ADefense mechanisms [V] 0.95
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.95
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.95
COG3547TransposaseMobilome: prophages, transposons [X] 0.95
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.95
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.95
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.38 %
UnclassifiedrootN/A27.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002IHP5NNot Available525Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100354737Not Available619Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100626926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300000956|JGI10216J12902_109184490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1141Open in IMG/M
3300005181|Ga0066678_10346688All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 14-4D979Open in IMG/M
3300005187|Ga0066675_10270339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1221Open in IMG/M
3300005332|Ga0066388_100075693All Organisms → cellular organisms → Bacteria3703Open in IMG/M
3300005332|Ga0066388_107628436All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium542Open in IMG/M
3300005437|Ga0070710_10556492Not Available793Open in IMG/M
3300005437|Ga0070710_10576883Not Available780Open in IMG/M
3300005610|Ga0070763_10639282Not Available619Open in IMG/M
3300005713|Ga0066905_100020535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3501Open in IMG/M
3300005713|Ga0066905_100947175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium756Open in IMG/M
3300005713|Ga0066905_101035840All Organisms → cellular organisms → Bacteria → Proteobacteria725Open in IMG/M
3300005713|Ga0066905_101132243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300005713|Ga0066905_101362639All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300005764|Ga0066903_102756939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium953Open in IMG/M
3300005764|Ga0066903_106688399Not Available600Open in IMG/M
3300005764|Ga0066903_107602574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300005764|Ga0066903_108525909Not Available522Open in IMG/M
3300005921|Ga0070766_10587822All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005937|Ga0081455_10515130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria800Open in IMG/M
3300006038|Ga0075365_11046495Not Available575Open in IMG/M
3300006059|Ga0075017_100099108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii2027Open in IMG/M
3300006755|Ga0079222_11225730Not Available675Open in IMG/M
3300006854|Ga0075425_101212330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium betae857Open in IMG/M
3300006914|Ga0075436_100336108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1087Open in IMG/M
3300006953|Ga0074063_10111812Not Available894Open in IMG/M
3300009143|Ga0099792_10065501All Organisms → cellular organisms → Bacteria → Proteobacteria1817Open in IMG/M
3300009143|Ga0099792_10285900All Organisms → cellular organisms → Bacteria → Proteobacteria973Open in IMG/M
3300009700|Ga0116217_10644400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae658Open in IMG/M
3300010043|Ga0126380_10382652All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300010046|Ga0126384_10291657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1337Open in IMG/M
3300010047|Ga0126382_11483933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300010048|Ga0126373_13207969All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010335|Ga0134063_10486224Not Available616Open in IMG/M
3300010358|Ga0126370_11216191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300010358|Ga0126370_11519452Not Available637Open in IMG/M
3300010359|Ga0126376_11381555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae728Open in IMG/M
3300010359|Ga0126376_12915142Not Available528Open in IMG/M
3300010362|Ga0126377_12348842Not Available609Open in IMG/M
3300010362|Ga0126377_13509639Not Available507Open in IMG/M
3300010366|Ga0126379_12103752All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300010366|Ga0126379_12906808All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300010398|Ga0126383_10014317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales5893Open in IMG/M
3300010398|Ga0126383_13590599Not Available507Open in IMG/M
3300010400|Ga0134122_13309189Not Available506Open in IMG/M
3300010863|Ga0124850_1043191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1428Open in IMG/M
3300012199|Ga0137383_10367867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1053Open in IMG/M
3300012202|Ga0137363_10067560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2619Open in IMG/M
3300012203|Ga0137399_10162738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1791Open in IMG/M
3300012683|Ga0137398_10085124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1958Open in IMG/M
3300012929|Ga0137404_11482040Not Available628Open in IMG/M
3300015356|Ga0134073_10407827All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300016294|Ga0182041_11257308All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300016319|Ga0182033_11193636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300016319|Ga0182033_11446212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300016357|Ga0182032_12050340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300016387|Ga0182040_11908486All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300016422|Ga0182039_10441756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1113Open in IMG/M
3300017933|Ga0187801_10145681Not Available920Open in IMG/M
3300017994|Ga0187822_10060083Not Available1088Open in IMG/M
3300017995|Ga0187816_10268065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae746Open in IMG/M
3300017999|Ga0187767_10095527Not Available818Open in IMG/M
3300018060|Ga0187765_10186543Not Available1191Open in IMG/M
3300018086|Ga0187769_10026949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3869Open in IMG/M
3300018086|Ga0187769_11275901Not Available556Open in IMG/M
3300018090|Ga0187770_10160583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1717Open in IMG/M
3300019886|Ga0193727_1037790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1615Open in IMG/M
3300020579|Ga0210407_10301211All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300021168|Ga0210406_10640457Not Available825Open in IMG/M
3300021407|Ga0210383_10639647Not Available916Open in IMG/M
3300021474|Ga0210390_10359224Not Available1232Open in IMG/M
3300022557|Ga0212123_10225325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1366Open in IMG/M
3300022756|Ga0222622_10787949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300025939|Ga0207665_10898397Not Available702Open in IMG/M
3300026547|Ga0209156_10041953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602490Open in IMG/M
3300026551|Ga0209648_10631858Not Available587Open in IMG/M
3300027583|Ga0209527_1154140All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031546|Ga0318538_10421457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium722Open in IMG/M
3300031549|Ga0318571_10137733All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300031572|Ga0318515_10653541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031736|Ga0318501_10486001All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300031747|Ga0318502_10349560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300031753|Ga0307477_10587096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae752Open in IMG/M
3300031771|Ga0318546_11082899All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300031792|Ga0318529_10207383Not Available909Open in IMG/M
3300031793|Ga0318548_10538698All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300031793|Ga0318548_10564973All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300031799|Ga0318565_10119185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1273Open in IMG/M
3300031805|Ga0318497_10063727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1924Open in IMG/M
3300031823|Ga0307478_10962750All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031897|Ga0318520_10571777All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300031941|Ga0310912_10896832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium682Open in IMG/M
3300031941|Ga0310912_11144549All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300031942|Ga0310916_10607100All Organisms → cellular organisms → Bacteria → Proteobacteria930Open in IMG/M
3300031942|Ga0310916_11533670All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300032010|Ga0318569_10117521All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300032044|Ga0318558_10682063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae514Open in IMG/M
3300032052|Ga0318506_10487660All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300032063|Ga0318504_10521614All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300032065|Ga0318513_10593407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300032090|Ga0318518_10555922All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300032091|Ga0318577_10019000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2830Open in IMG/M
3300032180|Ga0307471_102577758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales644Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.90%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.95%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.95%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_043204802170459003Grass SoilPNKDAMEEEDLRSYRDAMVRGPLRALLGRDRRLARAQQ
INPhiseqgaiiFebDRAFT_10035473723300000364SoilEAGQPIKRAMDEEDMRXXRXAXMRGPLRXXLGGDKRLARAQQ*
INPhiseqgaiiFebDRAFT_10062692633300000364SoilNKDAMDEEDLRSYREAMMRGPLRALLGGDKRLARAQQ*
JGI10216J12902_10918449033300000956SoilNAMDDEDLRSYREAVMPGPLRALLGGDKRLARAQQ*
Ga0066678_1034668813300005181SoilVLLGPKVTVKVEAGQPNKRAMDDEDLRSYREAMMRGPLRALLGGDKRLARVRQ*
Ga0066675_1027033913300005187SoilTLLLGPKVTVKAEGGQPNKNAMDQEDLRSYREAVMRGPLRAFFAGGRRLARAQQ*
Ga0066388_10007569343300005332Tropical Forest SoilLGPKVTVKADAGQPNKHAMDEEDLRSYREAMTQGPLRAFLRAEARLTRPRQ*
Ga0066388_10762843623300005332Tropical Forest SoilGPKVTVKAEAGQPNRTAMDEQDLRSYREAMMRGPFRPFFGGDKRLARAQQ*
Ga0070710_1055649223300005437Corn, Switchgrass And Miscanthus RhizosphereTVKAEAGQPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ*
Ga0070710_1057688313300005437Corn, Switchgrass And Miscanthus RhizosphereTKAEAGQPNKNAMDEEDFSSYRQAMARGPLHALLGKDERLARRR*
Ga0070763_1063928213300005610SoilGTMVLLGPKVTVKAEAGQPTRTAMDEEDIRSYREAVMRGPLRPFFGGSKRLARTQQ*
Ga0066905_10002053513300005713Tropical Forest SoilEAGQPNRQAMDAEDLRSYREAMTQGPLRALLGGSTRLAGARQ*
Ga0066905_10094717513300005713Tropical Forest SoilHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ*
Ga0066905_10103584023300005713Tropical Forest SoilLLGPKVTVKAEAGQPNKTAMDEEDIRSYREAMMRGPLRPFLGAEKRLARARQ*
Ga0066905_10113224323300005713Tropical Forest SoilLLGPKVTVKAEAGQPHKTAMDKEDLRSYREPMMRGPLRGLLGGDKRLARARQ*
Ga0066905_10136263913300005713Tropical Forest SoilPNKEAMDEEDLRDYRVAMRQGPLRAFLGTDNRLARLPQ*
Ga0066903_10275693933300005764Tropical Forest SoilGQPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLAGAQQ*
Ga0066903_10668839923300005764Tropical Forest SoilAGQPEKQAMDAEDLRGYREAMSRGPLRAFLGRGARLSSLAQ*
Ga0066903_10760257413300005764Tropical Forest SoilEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ*
Ga0066903_10852590913300005764Tropical Forest SoilGPKVTVKAEAGQPNRTAMDEQDLRSYREAMMRGPFRPFFGGDKRLTRAQQ*
Ga0070766_1058782213300005921SoilKEAMDEEDLRSYRDAMLRGPLRALLGGDKRLARAQR*
Ga0081455_1051513013300005937Tabebuia Heterophylla RhizosphereQPNKKAMDEEDLRNYREAMTRGPLRALLGGDKRLARAQQ*
Ga0075365_1104649513300006038Populus EndosphereVTVKAEAGQPNRQAMDADDLRSYREAMMRGPLRALLGGTTRLSAARQ*
Ga0075017_10009910853300006059WatershedsVKAEAGQPNKAAMDAEDLRSYRDAMLRGPLRALLGKEHLARAQQ*
Ga0079222_1122573023300006755Agricultural SoilPSKNAMDAEDLRSYREAMTRGPWRAFLGTDKRVARLRP*
Ga0075425_10121233023300006854Populus RhizosphereTTVLLGPKVTVKAEVGQPNKNAMDEEDFRSYREAMRQGLFRAFLGADRQLARLRE*
Ga0075436_10033610833300006914Populus RhizosphereNKNAMDQEDLRSYRAAMMRGPLRAFFAGDRRLARAQ*
Ga0074063_1011181223300006953SoilGQPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ*
Ga0099792_1006550113300009143Vadose Zone SoilAMDEEDLRSYREAMMQGPRRAPLGGNKRLAGARQ*
Ga0099792_1028590013300009143Vadose Zone SoilPKVTVKAEAGQPNRQAMDAEEMDAEDLRSYREAMMQGPLRALLGGNKRVAGARQ*
Ga0116217_1064440023300009700Peatlands SoilAMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ*
Ga0126380_1038265223300010043Tropical Forest SoilVKAEAGQPDKKAMDEEDFRTYRQAMMQGPFRALLAGGNKRLVQVDQ*
Ga0126384_1029165713300010046Tropical Forest SoilTAMDEEDLRSYREAAMRGRSGKFFGGDKRMARTQQ*
Ga0126382_1148393313300010047Tropical Forest SoilKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ*
Ga0126373_1320796913300010048Tropical Forest SoilLGPKVTVKAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ*
Ga0134063_1048622413300010335Grasslands SoilKVEAGQPNKRAMDEEDLRSYREAMMRGPLRALLGGDKRLARVRQ*
Ga0126370_1121619113300010358Tropical Forest SoilAGQPHKTAMDEEDLRSYREAMMRGPLRSLLGGDKRLTRARQ*
Ga0126370_1151945233300010358Tropical Forest SoilEAGQPNRTAMDEEDLGSYREAVIRGPFHPFFGGDKSLAQAQQ*
Ga0126376_1138155533300010359Tropical Forest SoilAMDAEDLRSYREALTQEPLRAPLGGARRLAGIPR*
Ga0126376_1291514213300010359Tropical Forest SoilTTVLLGPKVMVKAEAGQPNRTAMDEEDLRSYREAVMRGPSGKFFGGDKHMARTQQ*
Ga0126377_1234884213300010362Tropical Forest SoilAGQPNRTAMDEEDLRSYREAVMRGPSRTFFGGDNRVARTQQ*
Ga0126377_1350963913300010362Tropical Forest SoilVLLGPKVTIKAEAGQPNRTAMDEEDLRSYREAVIRGPFHPFFGGDKGLAQAQQ*
Ga0126379_1210375223300010366Tropical Forest SoilKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ*
Ga0126379_1290680813300010366Tropical Forest SoilAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ*
Ga0126383_1001431783300010398Tropical Forest SoilAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ*
Ga0126383_1359059913300010398Tropical Forest SoilPKVTVKAEAGQPDKKAMDEEDFRTYRQAMMQGPFRALLAGGNKRLVQVDQ*
Ga0134122_1330918913300010400Terrestrial SoilQPNKEAMEEEDLRSYRDAMLRGPLRALLGGDKRLARAQR*
Ga0124850_104319123300010863Tropical Forest SoilKVTVKAEAGQPSKTAMDEEDLRSYREAVMRGPLRPFFGGDKRLVRAQH*
Ga0137383_1036786713300012199Vadose Zone SoilLGPKVTVKAEEGQPNKEAMDEEDFRSYREAMTQGPLRMFLGADKRLARLRQ*
Ga0137363_1006756053300012202Vadose Zone SoilLGPKVTVKAEVGQPNKKAMDEEDLRSYREAMMRGPLRVGRQASARAQQ*
Ga0137399_1016273813300012203Vadose Zone SoilQPNRQAMDEEDLRSYREAMMQGPRRAPLGGNKRLAGARQ*
Ga0137398_1008512413300012683Vadose Zone SoilKVTIKAEGGQPNRTAMDEEDLRSYREAVMRGPFRPFFGGNKRLARAQQ*
Ga0137404_1148204033300012929Vadose Zone SoilGQPNKQAMDAEDLRSYREAMTQGPLRDLLGAHQRLAGAPQ*
Ga0134073_1040782713300015356Grasslands SoilLGPKVTVKAEGGQPNKNAMDQEDLRSYREAMMRGPLRALLGGDKRLARVRQ*
Ga0182041_1125730823300016294SoilVKAEVGQPNKEAMDEEDLRSYREAMAHGPLRALLGKDRQLARARQ
Ga0182033_1119363613300016319SoilEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARAPQ
Ga0182033_1144621213300016319SoilEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0182032_1205034013300016357SoilVKAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0182040_1190848613300016387SoilQPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ
Ga0182039_1044175613300016422SoilKAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ
Ga0187801_1014568123300017933Freshwater SedimentGQPNKEAMDAEDLRSYRDAMLRGPLRALLGEDKRLARARQ
Ga0187822_1006008313300017994Freshwater SedimentEAGQPNKQAMDEEDLRSYREAMMRGPLRALLGKNGNPAQAQR
Ga0187816_1026806513300017995Freshwater SedimentPVRDAMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ
Ga0187767_1009552723300017999Tropical PeatlandLGPRVTVKVEAGQPNRTAMDDEDLRSYREAMIRGPFGALLRGDKRLARAPQ
Ga0187765_1018654313300018060Tropical PeatlandPNKEAMDEEDLRNYREAMMRGPLRSLLGKNGNPAQAQR
Ga0187769_1002694973300018086Tropical PeatlandEAGQPNKEAMDEDDLRSYREAMARGPYRALLGNDRNWARAR
Ga0187769_1127590113300018086Tropical PeatlandEAGQPNKEAMDEDDLRSYREAMARGPYRALLGNDRNWARAQ
Ga0187770_1016058323300018090Tropical PeatlandPKVTVKAEAGQPNKEAMDEEDLRSYREVMVRGPLRSLLGAERRLAHAEQ
Ga0193727_103779033300019886SoilLLGPKVTVKAEAGQPERKAMDEGDMRSYREAMKIGPLRAFLEEGRHLAGAQQ
Ga0210407_1030121123300020579SoilEAGQPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ
Ga0210406_1064045713300021168SoilGELLGPKVTVKVEAGQPNKEAMEEEDLRSYRDAMLRGPLRALLGGDKRLARAQR
Ga0210383_1063964713300021407SoilAGQPNKDAMGEEDFRSYREVMARGPLRALLGKDGRLVQAP
Ga0210390_1035922423300021474SoilKVTVKAEAGQPNKYAMDEEDLRTYREAMVHGPLRALLGNDGRLARARR
Ga0212123_1022532523300022557Iron-Sulfur Acid SpringKAEAGQPNKEAMDEGDLRSYRDAMLRGPLRALLGGDKRLARAQQ
Ga0222622_1078794913300022756Groundwater SedimentKAEAGQPNKQAMDSEDLRSYREAMTQGPLRTLLDGHKRLAGAPQ
Ga0207665_1089839723300025939Corn, Switchgrass And Miscanthus RhizosphereVTVKAEAGQPNKTAMDEEDLRSYRAAMTQGPLRAFLGVDKRVAQTRR
Ga0209156_1004195353300026547SoilTLLLGPKVTVKAEGGQPNKNAMDQEDLRSYREAVMRGPLRAFFAGGRRLARAQQ
Ga0209648_1063185823300026551Grasslands SoilVVLGPKSTVKAEAGQPNKEAMDEEDFRSYREAMMRGPLRAFFGGDKRLARLGR
Ga0209527_115414023300027583Forest SoilMVLLGPKVTVKAEAGQPTRTAMDEEDIRSYREAVMRGPLRPFFGGSKRLARTQQ
Ga0318538_1042145723300031546SoilTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0318571_1013773313300031549SoilKAEAGQPNKQAMDEEDFRSYREAMMKGPLRALLGRDKLLARVQQ
Ga0318515_1065354123300031572SoilEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ
Ga0318501_1048600113300031736SoilKITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ
Ga0318502_1034956023300031747SoilAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0307477_1058709623300031753Hardwood Forest SoilEAGQPVRDAMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ
Ga0318546_1108289923300031771SoilAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ
Ga0318529_1020738323300031792SoilNKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ
Ga0318548_1053869813300031793SoilPKVTVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRAFLGRDNRLARAQQ
Ga0318548_1056497313300031793SoilKITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ
Ga0318565_1011918523300031799SoilVTVKAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ
Ga0318497_1006372713300031805SoilVLLGPKVTVKAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ
Ga0307478_1096275023300031823Hardwood Forest SoilNKYAMDEEDLRTYREAMVHGPLRGLLGNDGRLARARR
Ga0318520_1057177723300031897SoilQPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ
Ga0310912_1089683223300031941SoilKAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0310912_1114454913300031941SoilKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ
Ga0310916_1060710013300031942SoilKVTVKAEAGQLNKEAMDEEDLRNYREAMMRGPLRSLLGKNGNPAQAQR
Ga0310916_1153367013300031942SoilKVTVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRAFLGRDNRLARAQQ
Ga0318569_1011752113300032010SoilITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ
Ga0318558_1068206323300032044SoilAEAGQPARDAMDDEDLRSYREAIARGPLRALLGKAGRLVQAPQ
Ga0318506_1048766013300032052SoilEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ
Ga0318504_1052161413300032063SoilITVKAEAGQPNKKDMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ
Ga0318513_1059340723300032065SoilKVTVKAEAGQPHNTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ
Ga0318518_1055592213300032090SoilTAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ
Ga0318577_1001900053300032091SoilNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ
Ga0307471_10257775823300032180Hardwood Forest SoilVMVKAEAGQPNRTAMDEEDLRSYREAVMRGPSGKFFGDDRRMARTQQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.