| Basic Information | |
|---|---|
| Family ID | F095293 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.81 % |
| % of genes near scaffold ends (potentially truncated) | 91.43 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.238 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 20.00 |
| PF00753 | Lactamase_B | 5.71 |
| PF04073 | tRNA_edit | 3.81 |
| PF13505 | OMP_b-brl | 2.86 |
| PF04392 | ABC_sub_bind | 1.90 |
| PF13545 | HTH_Crp_2 | 1.90 |
| PF07883 | Cupin_2 | 1.90 |
| PF13343 | SBP_bac_6 | 1.90 |
| PF07690 | MFS_1 | 0.95 |
| PF01548 | DEDD_Tnp_IS110 | 0.95 |
| PF04828 | GFA | 0.95 |
| PF01135 | PCMT | 0.95 |
| PF00144 | Beta-lactamase | 0.95 |
| PF00355 | Rieske | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF01717 | Meth_synt_2 | 0.95 |
| PF00975 | Thioesterase | 0.95 |
| PF07045 | DUF1330 | 0.95 |
| PF07992 | Pyr_redox_2 | 0.95 |
| PF03047 | ComC | 0.95 |
| PF13602 | ADH_zinc_N_2 | 0.95 |
| PF00903 | Glyoxalase | 0.95 |
| PF05598 | DUF772 | 0.95 |
| PF00353 | HemolysinCabind | 0.95 |
| PF13489 | Methyltransf_23 | 0.95 |
| PF00756 | Esterase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 20.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.90 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.95 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.95 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.95 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.38 % |
| Unclassified | root | N/A | 27.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002IHP5N | Not Available | 525 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100354737 | Not Available | 619 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100626926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300000956|JGI10216J12902_109184490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1141 | Open in IMG/M |
| 3300005181|Ga0066678_10346688 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 14-4D | 979 | Open in IMG/M |
| 3300005187|Ga0066675_10270339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1221 | Open in IMG/M |
| 3300005332|Ga0066388_100075693 | All Organisms → cellular organisms → Bacteria | 3703 | Open in IMG/M |
| 3300005332|Ga0066388_107628436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 542 | Open in IMG/M |
| 3300005437|Ga0070710_10556492 | Not Available | 793 | Open in IMG/M |
| 3300005437|Ga0070710_10576883 | Not Available | 780 | Open in IMG/M |
| 3300005610|Ga0070763_10639282 | Not Available | 619 | Open in IMG/M |
| 3300005713|Ga0066905_100020535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3501 | Open in IMG/M |
| 3300005713|Ga0066905_100947175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300005713|Ga0066905_101035840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300005713|Ga0066905_101132243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300005713|Ga0066905_101362639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300005764|Ga0066903_102756939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300005764|Ga0066903_106688399 | Not Available | 600 | Open in IMG/M |
| 3300005764|Ga0066903_107602574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005764|Ga0066903_108525909 | Not Available | 522 | Open in IMG/M |
| 3300005921|Ga0070766_10587822 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005937|Ga0081455_10515130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300006038|Ga0075365_11046495 | Not Available | 575 | Open in IMG/M |
| 3300006059|Ga0075017_100099108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2027 | Open in IMG/M |
| 3300006755|Ga0079222_11225730 | Not Available | 675 | Open in IMG/M |
| 3300006854|Ga0075425_101212330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium betae | 857 | Open in IMG/M |
| 3300006914|Ga0075436_100336108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1087 | Open in IMG/M |
| 3300006953|Ga0074063_10111812 | Not Available | 894 | Open in IMG/M |
| 3300009143|Ga0099792_10065501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1817 | Open in IMG/M |
| 3300009143|Ga0099792_10285900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
| 3300009700|Ga0116217_10644400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 658 | Open in IMG/M |
| 3300010043|Ga0126380_10382652 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300010046|Ga0126384_10291657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1337 | Open in IMG/M |
| 3300010047|Ga0126382_11483933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300010048|Ga0126373_13207969 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010335|Ga0134063_10486224 | Not Available | 616 | Open in IMG/M |
| 3300010358|Ga0126370_11216191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300010358|Ga0126370_11519452 | Not Available | 637 | Open in IMG/M |
| 3300010359|Ga0126376_11381555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 728 | Open in IMG/M |
| 3300010359|Ga0126376_12915142 | Not Available | 528 | Open in IMG/M |
| 3300010362|Ga0126377_12348842 | Not Available | 609 | Open in IMG/M |
| 3300010362|Ga0126377_13509639 | Not Available | 507 | Open in IMG/M |
| 3300010366|Ga0126379_12103752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300010366|Ga0126379_12906808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300010398|Ga0126383_10014317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5893 | Open in IMG/M |
| 3300010398|Ga0126383_13590599 | Not Available | 507 | Open in IMG/M |
| 3300010400|Ga0134122_13309189 | Not Available | 506 | Open in IMG/M |
| 3300010863|Ga0124850_1043191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1428 | Open in IMG/M |
| 3300012199|Ga0137383_10367867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
| 3300012202|Ga0137363_10067560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2619 | Open in IMG/M |
| 3300012203|Ga0137399_10162738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1791 | Open in IMG/M |
| 3300012683|Ga0137398_10085124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1958 | Open in IMG/M |
| 3300012929|Ga0137404_11482040 | Not Available | 628 | Open in IMG/M |
| 3300015356|Ga0134073_10407827 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300016294|Ga0182041_11257308 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300016319|Ga0182033_11193636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300016319|Ga0182033_11446212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300016357|Ga0182032_12050340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300016387|Ga0182040_11908486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300016422|Ga0182039_10441756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1113 | Open in IMG/M |
| 3300017933|Ga0187801_10145681 | Not Available | 920 | Open in IMG/M |
| 3300017994|Ga0187822_10060083 | Not Available | 1088 | Open in IMG/M |
| 3300017995|Ga0187816_10268065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 746 | Open in IMG/M |
| 3300017999|Ga0187767_10095527 | Not Available | 818 | Open in IMG/M |
| 3300018060|Ga0187765_10186543 | Not Available | 1191 | Open in IMG/M |
| 3300018086|Ga0187769_10026949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3869 | Open in IMG/M |
| 3300018086|Ga0187769_11275901 | Not Available | 556 | Open in IMG/M |
| 3300018090|Ga0187770_10160583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1717 | Open in IMG/M |
| 3300019886|Ga0193727_1037790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1615 | Open in IMG/M |
| 3300020579|Ga0210407_10301211 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300021168|Ga0210406_10640457 | Not Available | 825 | Open in IMG/M |
| 3300021407|Ga0210383_10639647 | Not Available | 916 | Open in IMG/M |
| 3300021474|Ga0210390_10359224 | Not Available | 1232 | Open in IMG/M |
| 3300022557|Ga0212123_10225325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1366 | Open in IMG/M |
| 3300022756|Ga0222622_10787949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300025939|Ga0207665_10898397 | Not Available | 702 | Open in IMG/M |
| 3300026547|Ga0209156_10041953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2490 | Open in IMG/M |
| 3300026551|Ga0209648_10631858 | Not Available | 587 | Open in IMG/M |
| 3300027583|Ga0209527_1154140 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031546|Ga0318538_10421457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300031549|Ga0318571_10137733 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031572|Ga0318515_10653541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300031736|Ga0318501_10486001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300031747|Ga0318502_10349560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300031753|Ga0307477_10587096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 752 | Open in IMG/M |
| 3300031771|Ga0318546_11082899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300031792|Ga0318529_10207383 | Not Available | 909 | Open in IMG/M |
| 3300031793|Ga0318548_10538698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031793|Ga0318548_10564973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031799|Ga0318565_10119185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300031805|Ga0318497_10063727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1924 | Open in IMG/M |
| 3300031823|Ga0307478_10962750 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031897|Ga0318520_10571777 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031941|Ga0310912_10896832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300031941|Ga0310912_11144549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300031942|Ga0310916_10607100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300031942|Ga0310916_11533670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300032010|Ga0318569_10117521 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300032044|Ga0318558_10682063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 514 | Open in IMG/M |
| 3300032052|Ga0318506_10487660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300032063|Ga0318504_10521614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300032065|Ga0318513_10593407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300032090|Ga0318518_10555922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300032091|Ga0318577_10019000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2830 | Open in IMG/M |
| 3300032180|Ga0307471_102577758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 644 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_04320480 | 2170459003 | Grass Soil | PNKDAMEEEDLRSYRDAMVRGPLRALLGRDRRLARAQQ |
| INPhiseqgaiiFebDRAFT_1003547372 | 3300000364 | Soil | EAGQPIKRAMDEEDMRXXRXAXMRGPLRXXLGGDKRLARAQQ* |
| INPhiseqgaiiFebDRAFT_1006269263 | 3300000364 | Soil | NKDAMDEEDLRSYREAMMRGPLRALLGGDKRLARAQQ* |
| JGI10216J12902_1091844903 | 3300000956 | Soil | NAMDDEDLRSYREAVMPGPLRALLGGDKRLARAQQ* |
| Ga0066678_103466881 | 3300005181 | Soil | VLLGPKVTVKVEAGQPNKRAMDDEDLRSYREAMMRGPLRALLGGDKRLARVRQ* |
| Ga0066675_102703391 | 3300005187 | Soil | TLLLGPKVTVKAEGGQPNKNAMDQEDLRSYREAVMRGPLRAFFAGGRRLARAQQ* |
| Ga0066388_1000756934 | 3300005332 | Tropical Forest Soil | LGPKVTVKADAGQPNKHAMDEEDLRSYREAMTQGPLRAFLRAEARLTRPRQ* |
| Ga0066388_1076284362 | 3300005332 | Tropical Forest Soil | GPKVTVKAEAGQPNRTAMDEQDLRSYREAMMRGPFRPFFGGDKRLARAQQ* |
| Ga0070710_105564922 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TVKAEAGQPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ* |
| Ga0070710_105768831 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TKAEAGQPNKNAMDEEDFSSYRQAMARGPLHALLGKDERLARRR* |
| Ga0070763_106392821 | 3300005610 | Soil | GTMVLLGPKVTVKAEAGQPTRTAMDEEDIRSYREAVMRGPLRPFFGGSKRLARTQQ* |
| Ga0066905_1000205351 | 3300005713 | Tropical Forest Soil | EAGQPNRQAMDAEDLRSYREAMTQGPLRALLGGSTRLAGARQ* |
| Ga0066905_1009471751 | 3300005713 | Tropical Forest Soil | HKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ* |
| Ga0066905_1010358402 | 3300005713 | Tropical Forest Soil | LLGPKVTVKAEAGQPNKTAMDEEDIRSYREAMMRGPLRPFLGAEKRLARARQ* |
| Ga0066905_1011322432 | 3300005713 | Tropical Forest Soil | LLGPKVTVKAEAGQPHKTAMDKEDLRSYREPMMRGPLRGLLGGDKRLARARQ* |
| Ga0066905_1013626391 | 3300005713 | Tropical Forest Soil | PNKEAMDEEDLRDYRVAMRQGPLRAFLGTDNRLARLPQ* |
| Ga0066903_1027569393 | 3300005764 | Tropical Forest Soil | GQPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLAGAQQ* |
| Ga0066903_1066883992 | 3300005764 | Tropical Forest Soil | AGQPEKQAMDAEDLRGYREAMSRGPLRAFLGRGARLSSLAQ* |
| Ga0066903_1076025741 | 3300005764 | Tropical Forest Soil | EAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ* |
| Ga0066903_1085259091 | 3300005764 | Tropical Forest Soil | GPKVTVKAEAGQPNRTAMDEQDLRSYREAMMRGPFRPFFGGDKRLTRAQQ* |
| Ga0070766_105878221 | 3300005921 | Soil | KEAMDEEDLRSYRDAMLRGPLRALLGGDKRLARAQR* |
| Ga0081455_105151301 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QPNKKAMDEEDLRNYREAMTRGPLRALLGGDKRLARAQQ* |
| Ga0075365_110464951 | 3300006038 | Populus Endosphere | VTVKAEAGQPNRQAMDADDLRSYREAMMRGPLRALLGGTTRLSAARQ* |
| Ga0075017_1000991085 | 3300006059 | Watersheds | VKAEAGQPNKAAMDAEDLRSYRDAMLRGPLRALLGKEHLARAQQ* |
| Ga0079222_112257302 | 3300006755 | Agricultural Soil | PSKNAMDAEDLRSYREAMTRGPWRAFLGTDKRVARLRP* |
| Ga0075425_1012123302 | 3300006854 | Populus Rhizosphere | TTVLLGPKVTVKAEVGQPNKNAMDEEDFRSYREAMRQGLFRAFLGADRQLARLRE* |
| Ga0075436_1003361083 | 3300006914 | Populus Rhizosphere | NKNAMDQEDLRSYRAAMMRGPLRAFFAGDRRLARAQ* |
| Ga0074063_101118122 | 3300006953 | Soil | GQPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ* |
| Ga0099792_100655011 | 3300009143 | Vadose Zone Soil | AMDEEDLRSYREAMMQGPRRAPLGGNKRLAGARQ* |
| Ga0099792_102859001 | 3300009143 | Vadose Zone Soil | PKVTVKAEAGQPNRQAMDAEEMDAEDLRSYREAMMQGPLRALLGGNKRVAGARQ* |
| Ga0116217_106444002 | 3300009700 | Peatlands Soil | AMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ* |
| Ga0126380_103826522 | 3300010043 | Tropical Forest Soil | VKAEAGQPDKKAMDEEDFRTYRQAMMQGPFRALLAGGNKRLVQVDQ* |
| Ga0126384_102916571 | 3300010046 | Tropical Forest Soil | TAMDEEDLRSYREAAMRGRSGKFFGGDKRMARTQQ* |
| Ga0126382_114839331 | 3300010047 | Tropical Forest Soil | KTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ* |
| Ga0126373_132079691 | 3300010048 | Tropical Forest Soil | LGPKVTVKAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ* |
| Ga0134063_104862241 | 3300010335 | Grasslands Soil | KVEAGQPNKRAMDEEDLRSYREAMMRGPLRALLGGDKRLARVRQ* |
| Ga0126370_112161911 | 3300010358 | Tropical Forest Soil | AGQPHKTAMDEEDLRSYREAMMRGPLRSLLGGDKRLTRARQ* |
| Ga0126370_115194523 | 3300010358 | Tropical Forest Soil | EAGQPNRTAMDEEDLGSYREAVIRGPFHPFFGGDKSLAQAQQ* |
| Ga0126376_113815553 | 3300010359 | Tropical Forest Soil | AMDAEDLRSYREALTQEPLRAPLGGARRLAGIPR* |
| Ga0126376_129151421 | 3300010359 | Tropical Forest Soil | TTVLLGPKVMVKAEAGQPNRTAMDEEDLRSYREAVMRGPSGKFFGGDKHMARTQQ* |
| Ga0126377_123488421 | 3300010362 | Tropical Forest Soil | AGQPNRTAMDEEDLRSYREAVMRGPSRTFFGGDNRVARTQQ* |
| Ga0126377_135096391 | 3300010362 | Tropical Forest Soil | VLLGPKVTIKAEAGQPNRTAMDEEDLRSYREAVIRGPFHPFFGGDKGLAQAQQ* |
| Ga0126379_121037522 | 3300010366 | Tropical Forest Soil | KAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ* |
| Ga0126379_129068081 | 3300010366 | Tropical Forest Soil | AGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ* |
| Ga0126383_100143178 | 3300010398 | Tropical Forest Soil | AMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ* |
| Ga0126383_135905991 | 3300010398 | Tropical Forest Soil | PKVTVKAEAGQPDKKAMDEEDFRTYRQAMMQGPFRALLAGGNKRLVQVDQ* |
| Ga0134122_133091891 | 3300010400 | Terrestrial Soil | QPNKEAMEEEDLRSYRDAMLRGPLRALLGGDKRLARAQR* |
| Ga0124850_10431912 | 3300010863 | Tropical Forest Soil | KVTVKAEAGQPSKTAMDEEDLRSYREAVMRGPLRPFFGGDKRLVRAQH* |
| Ga0137383_103678671 | 3300012199 | Vadose Zone Soil | LGPKVTVKAEEGQPNKEAMDEEDFRSYREAMTQGPLRMFLGADKRLARLRQ* |
| Ga0137363_100675605 | 3300012202 | Vadose Zone Soil | LGPKVTVKAEVGQPNKKAMDEEDLRSYREAMMRGPLRVGRQASARAQQ* |
| Ga0137399_101627381 | 3300012203 | Vadose Zone Soil | QPNRQAMDEEDLRSYREAMMQGPRRAPLGGNKRLAGARQ* |
| Ga0137398_100851241 | 3300012683 | Vadose Zone Soil | KVTIKAEGGQPNRTAMDEEDLRSYREAVMRGPFRPFFGGNKRLARAQQ* |
| Ga0137404_114820403 | 3300012929 | Vadose Zone Soil | GQPNKQAMDAEDLRSYREAMTQGPLRDLLGAHQRLAGAPQ* |
| Ga0134073_104078271 | 3300015356 | Grasslands Soil | LGPKVTVKAEGGQPNKNAMDQEDLRSYREAMMRGPLRALLGGDKRLARVRQ* |
| Ga0182041_112573082 | 3300016294 | Soil | VKAEVGQPNKEAMDEEDLRSYREAMAHGPLRALLGKDRQLARARQ |
| Ga0182033_111936361 | 3300016319 | Soil | EAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARAPQ |
| Ga0182033_114462121 | 3300016319 | Soil | EAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0182032_120503401 | 3300016357 | Soil | VKAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0182040_119084861 | 3300016387 | Soil | QPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ |
| Ga0182039_104417561 | 3300016422 | Soil | KAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ |
| Ga0187801_101456812 | 3300017933 | Freshwater Sediment | GQPNKEAMDAEDLRSYRDAMLRGPLRALLGEDKRLARARQ |
| Ga0187822_100600831 | 3300017994 | Freshwater Sediment | EAGQPNKQAMDEEDLRSYREAMMRGPLRALLGKNGNPAQAQR |
| Ga0187816_102680651 | 3300017995 | Freshwater Sediment | PVRDAMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ |
| Ga0187767_100955272 | 3300017999 | Tropical Peatland | LGPRVTVKVEAGQPNRTAMDDEDLRSYREAMIRGPFGALLRGDKRLARAPQ |
| Ga0187765_101865431 | 3300018060 | Tropical Peatland | PNKEAMDEEDLRNYREAMMRGPLRSLLGKNGNPAQAQR |
| Ga0187769_100269497 | 3300018086 | Tropical Peatland | EAGQPNKEAMDEDDLRSYREAMARGPYRALLGNDRNWARAR |
| Ga0187769_112759011 | 3300018086 | Tropical Peatland | EAGQPNKEAMDEDDLRSYREAMARGPYRALLGNDRNWARAQ |
| Ga0187770_101605832 | 3300018090 | Tropical Peatland | PKVTVKAEAGQPNKEAMDEEDLRSYREVMVRGPLRSLLGAERRLAHAEQ |
| Ga0193727_10377903 | 3300019886 | Soil | LLGPKVTVKAEAGQPERKAMDEGDMRSYREAMKIGPLRAFLEEGRHLAGAQQ |
| Ga0210407_103012112 | 3300020579 | Soil | EAGQPNKKAMDEEDLRGYREAMTRGPLRAFLGRDNRLARAQQ |
| Ga0210406_106404571 | 3300021168 | Soil | GELLGPKVTVKVEAGQPNKEAMEEEDLRSYRDAMLRGPLRALLGGDKRLARAQR |
| Ga0210383_106396471 | 3300021407 | Soil | AGQPNKDAMGEEDFRSYREVMARGPLRALLGKDGRLVQAP |
| Ga0210390_103592242 | 3300021474 | Soil | KVTVKAEAGQPNKYAMDEEDLRTYREAMVHGPLRALLGNDGRLARARR |
| Ga0212123_102253252 | 3300022557 | Iron-Sulfur Acid Spring | KAEAGQPNKEAMDEGDLRSYRDAMLRGPLRALLGGDKRLARAQQ |
| Ga0222622_107879491 | 3300022756 | Groundwater Sediment | KAEAGQPNKQAMDSEDLRSYREAMTQGPLRTLLDGHKRLAGAPQ |
| Ga0207665_108983972 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVKAEAGQPNKTAMDEEDLRSYRAAMTQGPLRAFLGVDKRVAQTRR |
| Ga0209156_100419535 | 3300026547 | Soil | TLLLGPKVTVKAEGGQPNKNAMDQEDLRSYREAVMRGPLRAFFAGGRRLARAQQ |
| Ga0209648_106318582 | 3300026551 | Grasslands Soil | VVLGPKSTVKAEAGQPNKEAMDEEDFRSYREAMMRGPLRAFFGGDKRLARLGR |
| Ga0209527_11541402 | 3300027583 | Forest Soil | MVLLGPKVTVKAEAGQPTRTAMDEEDIRSYREAVMRGPLRPFFGGSKRLARTQQ |
| Ga0318538_104214572 | 3300031546 | Soil | TAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0318571_101377331 | 3300031549 | Soil | KAEAGQPNKQAMDEEDFRSYREAMMKGPLRALLGRDKLLARVQQ |
| Ga0318515_106535412 | 3300031572 | Soil | EAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ |
| Ga0318501_104860011 | 3300031736 | Soil | KITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ |
| Ga0318502_103495602 | 3300031747 | Soil | AEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0307477_105870962 | 3300031753 | Hardwood Forest Soil | EAGQPVRDAMDEEDLRSYREAMARGPLRALLGRGERLVRTPQ |
| Ga0318546_110828992 | 3300031771 | Soil | AGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDKRLARAQQ |
| Ga0318529_102073832 | 3300031792 | Soil | NKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ |
| Ga0318548_105386981 | 3300031793 | Soil | PKVTVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRAFLGRDNRLARAQQ |
| Ga0318548_105649731 | 3300031793 | Soil | KITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0318565_101191852 | 3300031799 | Soil | VTVKAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ |
| Ga0318497_100637271 | 3300031805 | Soil | VLLGPKVTVKAEAGQPYKNAMDEEDLRSYREAMMRGPLRGLLGGDKRLTRVGQ |
| Ga0307478_109627502 | 3300031823 | Hardwood Forest Soil | NKYAMDEEDLRTYREAMVHGPLRGLLGNDGRLARARR |
| Ga0318520_105717772 | 3300031897 | Soil | QPNKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0310912_108968322 | 3300031941 | Soil | KAEAGQPHKTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0310912_111445491 | 3300031941 | Soil | KKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0310916_106071001 | 3300031942 | Soil | KVTVKAEAGQLNKEAMDEEDLRNYREAMMRGPLRSLLGKNGNPAQAQR |
| Ga0310916_115336701 | 3300031942 | Soil | KVTVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRAFLGRDNRLARAQQ |
| Ga0318569_101175211 | 3300032010 | Soil | ITVKAEAGQPNKKAMDEEDLRSYREAMTRGPLRALLGSDNRLAGAQQ |
| Ga0318558_106820632 | 3300032044 | Soil | AEAGQPARDAMDDEDLRSYREAIARGPLRALLGKAGRLVQAPQ |
| Ga0318506_104876601 | 3300032052 | Soil | EAGQPNKKAMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0318504_105216141 | 3300032063 | Soil | ITVKAEAGQPNKKDMDEEDLRSYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0318513_105934072 | 3300032065 | Soil | KVTVKAEAGQPHNTAMDEEDLRSYREAMMRGPLRGLLGGDKRLARARQ |
| Ga0318518_105559221 | 3300032090 | Soil | TAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0318577_100190005 | 3300032091 | Soil | NKKAMDEEDLRGYREAMTRGPLRALLGRDNRLARAQQ |
| Ga0307471_1025777582 | 3300032180 | Hardwood Forest Soil | VMVKAEAGQPNRTAMDEEDLRSYREAVMRGPSGKFFGDDRRMARTQQ |
| ⦗Top⦘ |