| Basic Information | |
|---|---|
| Family ID | F095292 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 39 residues |
| Representative Sequence | TAAGAKVFAAGALNFGASVGDPVVARLLENVWARLSRP |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.524 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02737 | 3HCDH_N | 45.71 |
| PF00725 | 3HCDH | 14.29 |
| PF02803 | Thiolase_C | 3.81 |
| PF01370 | Epimerase | 2.86 |
| PF00561 | Abhydrolase_1 | 2.86 |
| PF08241 | Methyltransf_11 | 1.90 |
| PF00484 | Pro_CA | 1.90 |
| PF00106 | adh_short | 0.95 |
| PF02541 | Ppx-GppA | 0.95 |
| PF00082 | Peptidase_S8 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 60.00 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 45.71 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 45.71 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 45.71 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 45.71 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 45.71 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 45.71 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 3.81 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.90 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 1.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.52 % |
| Unclassified | root | N/A | 10.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig144340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 2140918013|NODE_8250_length_1129_cov_4.449956 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300001978|JGI24747J21853_1002893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1446 | Open in IMG/M |
| 3300002244|JGI24742J22300_10006037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1996 | Open in IMG/M |
| 3300004081|Ga0063454_100117378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1319 | Open in IMG/M |
| 3300005093|Ga0062594_100092856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300005328|Ga0070676_11280867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300005435|Ga0070714_100884441 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300005445|Ga0070708_100288030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1546 | Open in IMG/M |
| 3300005544|Ga0070686_100484868 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005552|Ga0066701_10912986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300005558|Ga0066698_10110381 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300005558|Ga0066698_10348956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300005568|Ga0066703_10848973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005764|Ga0066903_104786160 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006755|Ga0079222_11332298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 657 | Open in IMG/M |
| 3300006791|Ga0066653_10321038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300006854|Ga0075425_100548668 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300006854|Ga0075425_102300136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300006854|Ga0075425_103138561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300006953|Ga0074063_13590144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1899 | Open in IMG/M |
| 3300009012|Ga0066710_101885338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300009012|Ga0066710_103911327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300009093|Ga0105240_11523011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300009137|Ga0066709_102743670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300009137|Ga0066709_103120221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300009156|Ga0111538_11441422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300009156|Ga0111538_11510754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300009162|Ga0075423_12198487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300009545|Ga0105237_12544468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300010039|Ga0126309_10484602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300010039|Ga0126309_11252187 | Not Available | 512 | Open in IMG/M |
| 3300010166|Ga0126306_10932240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300010321|Ga0134067_10274427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300010326|Ga0134065_10420888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300010333|Ga0134080_10174344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300010333|Ga0134080_10499815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300010333|Ga0134080_10549094 | Not Available | 555 | Open in IMG/M |
| 3300010333|Ga0134080_10600543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300010373|Ga0134128_12720586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300010399|Ga0134127_13105567 | Not Available | 542 | Open in IMG/M |
| 3300010400|Ga0134122_13036995 | Not Available | 524 | Open in IMG/M |
| 3300010401|Ga0134121_10914037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300012001|Ga0120167_1006694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3618 | Open in IMG/M |
| 3300012200|Ga0137382_10191639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300012201|Ga0137365_11121840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300012285|Ga0137370_10273222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300012354|Ga0137366_10156678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1712 | Open in IMG/M |
| 3300012355|Ga0137369_10818239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300012355|Ga0137369_11133746 | Not Available | 508 | Open in IMG/M |
| 3300012356|Ga0137371_10343982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300012356|Ga0137371_11043825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300012473|Ga0157340_1019575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300012503|Ga0157313_1028342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300012907|Ga0157283_10301251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300012912|Ga0157306_10179403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300012915|Ga0157302_10540046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300012948|Ga0126375_10619737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300013105|Ga0157369_11393839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300013297|Ga0157378_10271844 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300014497|Ga0182008_10922090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300014969|Ga0157376_10649083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300015209|Ga0167629_1042071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1569 | Open in IMG/M |
| 3300018054|Ga0184621_10032695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
| 3300018066|Ga0184617_1096781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300018071|Ga0184618_10081402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1239 | Open in IMG/M |
| 3300018072|Ga0184635_10150855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300018465|Ga0190269_10411224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300018466|Ga0190268_11141370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300018468|Ga0066662_12277787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300018482|Ga0066669_10498613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
| 3300018482|Ga0066669_12092435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300019269|Ga0184644_1610147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300021073|Ga0210378_10095402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
| 3300022694|Ga0222623_10226798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300022898|Ga0247745_1035727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300022898|Ga0247745_1037445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300025911|Ga0207654_10310079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300025913|Ga0207695_10895474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300025922|Ga0207646_10401040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
| 3300025925|Ga0207650_11552849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300025927|Ga0207687_11192683 | Not Available | 654 | Open in IMG/M |
| 3300025949|Ga0207667_11643959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300025996|Ga0208777_1018875 | Not Available | 590 | Open in IMG/M |
| 3300026078|Ga0207702_10456715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300026529|Ga0209806_1317042 | Not Available | 523 | Open in IMG/M |
| 3300027907|Ga0207428_10111034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2110 | Open in IMG/M |
| 3300028707|Ga0307291_1039888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300028711|Ga0307293_10040639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300028712|Ga0307285_10150950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300028715|Ga0307313_10164046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300028716|Ga0307311_10128254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300028719|Ga0307301_10027307 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300028782|Ga0307306_10207518 | Not Available | 563 | Open in IMG/M |
| 3300028782|Ga0307306_10271625 | Not Available | 501 | Open in IMG/M |
| 3300028791|Ga0307290_10188046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300028793|Ga0307299_10081457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300028799|Ga0307284_10194383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300028807|Ga0307305_10348475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300028824|Ga0307310_10117991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300028876|Ga0307286_10285578 | Not Available | 608 | Open in IMG/M |
| 3300028881|Ga0307277_10029367 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300028884|Ga0307308_10229781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300033407|Ga0214472_11422305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300033550|Ga0247829_10356104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_00765790 | 2124908041 | Soil | PQGAKVFAAGTLDFAASLDRPDVSRLVDNVWARLATP |
| Iowa-Corn-GraphCirc_03393010 | 2140918013 | Soil | YYETPAGAKVFAAGALNFAASVDQPVVSQLLENLWGRLSLP |
| JGI24747J21853_10028934 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | YETPSGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP* |
| JGI24742J22300_100060374 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | PSGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP* |
| Ga0063454_1001173781 | 3300004081 | Soil | ETARGARVFAAGTLDFAASLDDPAVARLVENVWARLSRP* |
| Ga0062594_1000928561 | 3300005093 | Soil | ETPAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSAP* |
| Ga0070676_112808671 | 3300005328 | Miscanthus Rhizosphere | MTYYETPAGAKVFAAGVLNFAASIDDPQVTRLVDNVWRKLSGAA* |
| Ga0070714_1008844413 | 3300005435 | Agricultural Soil | ETPAGAKVFAAGVINFGASLQDPAVERLLANVWARLIVP* |
| Ga0070708_1002880301 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YYETLAGAKVFAAGTLDFAASLDTAVVSRLVDNVWARLAAP* |
| Ga0070686_1004848682 | 3300005544 | Switchgrass Rhizosphere | YESASGARVFAAGTLDFTASITDPAVSQLVQNVWTRLAR* |
| Ga0066701_109129861 | 3300005552 | Soil | TPAGAKVFAAGALNFAASIGDPTVSQLVGNVWSRLSRP* |
| Ga0066698_101103811 | 3300005558 | Soil | AGAKVFAAGALNFAASVDDPVVARLLDNVWARLTRP* |
| Ga0066698_103489562 | 3300005558 | Soil | AGAKVFAAGALNFASSIGDATVAQLVENVWARLSRP* |
| Ga0066703_108489732 | 3300005568 | Soil | AKVFAAGALNFGASVDDPVVARLLENVWARLSRP* |
| Ga0066903_1047861603 | 3300005764 | Tropical Forest Soil | PAGAKVFAAGALDFAASIDDPSVSRLVANLWDRLSQP* |
| Ga0079222_113322983 | 3300006755 | Agricultural Soil | GAKVFAAGVINFGASLGEPAVDRLLTNVWSRLAVP* |
| Ga0066653_103210381 | 3300006791 | Soil | TYYETAAGARVFAAGALNFGASVGDPVVARILDNVWTRLSTP* |
| Ga0075425_1005486683 | 3300006854 | Populus Rhizosphere | YETNAGARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR* |
| Ga0075425_1023001362 | 3300006854 | Populus Rhizosphere | YETPSGAKVFAAGALNFTASIGDPAVAQLVENVWTRLSRP* |
| Ga0075425_1031385611 | 3300006854 | Populus Rhizosphere | AKVFAAGALNFAASLDDPAVARLVDNVWSHLSVP* |
| Ga0074063_135901441 | 3300006953 | Soil | GSGARVFAAGALNFGASITDPAVSRLVENVWARLAR* |
| Ga0066710_1018853381 | 3300009012 | Grasslands Soil | LGPGRSAEMTHYETPAGAKVFAPRALTFASSLGQPVVDRLLANVWARLTIP |
| Ga0066710_1039113271 | 3300009012 | Grasslands Soil | ETPAGAKVFATGTLDFAASLDRPDVSRLVDDIWARLSAP |
| Ga0105240_115230112 | 3300009093 | Corn Rhizosphere | YESASGARVFAAGALNFAASITDPAVSRLVENVWARLAR* |
| Ga0066709_1027436702 | 3300009137 | Grasslands Soil | YETPAGAKVFAAGTLDFAASLGNPVVSRLVDNVWTRLAMP* |
| Ga0066709_1031202212 | 3300009137 | Grasslands Soil | TPAGAKVFAAGAIDFAASLGVPAVSRLVDNVWARFTAP* |
| Ga0111538_114414222 | 3300009156 | Populus Rhizosphere | AKVFAAGALNFAASIGDPEVAQLVENLWTRLSVP* |
| Ga0111538_115107543 | 3300009156 | Populus Rhizosphere | ETPAGAKVFAAGSLNFGASLGRPEVDRLLSNMWTRLSVP* |
| Ga0075423_121984873 | 3300009162 | Populus Rhizosphere | YESPAGAKVFAAGTLNFAASLDRPDVSRLVDNVWARLSAP* |
| Ga0105237_125444682 | 3300009545 | Corn Rhizosphere | AGAKVFAAGALNFGASVGDPVVTRILDNLWARLSRP* |
| Ga0126309_104846022 | 3300010039 | Serpentine Soil | TYYETPAGARVFAAGVVNFGASITDPPVSRLIENVWSRLAR* |
| Ga0126309_112521872 | 3300010039 | Serpentine Soil | GGKVFAAGALNFAATLDRADVSRLVDNVWRRLASP* |
| Ga0126306_109322401 | 3300010166 | Serpentine Soil | GAKVFAAGSLNFGASLGRPEVDRLLANVWARLGVP* |
| Ga0134067_102744272 | 3300010321 | Grasslands Soil | YYETPRGAKVFAAGALNFAASADVPAVSQLLENVWARLSRP* |
| Ga0134065_104208881 | 3300010326 | Grasslands Soil | AGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP* |
| Ga0134080_101743441 | 3300010333 | Grasslands Soil | YYETPAGAKVFAAGALNFAASLGRPDVARLVENVWTRLSAP* |
| Ga0134080_104998152 | 3300010333 | Grasslands Soil | LYRTPAGARVFAAGAIDFAASIGLPAVSRLVDNIWARFTAP* |
| Ga0134080_105490942 | 3300010333 | Grasslands Soil | LPRGAKVFAAGALNFGGSMADPAVARLVGNVWDRLSQP* |
| Ga0134080_106005431 | 3300010333 | Grasslands Soil | APSGARVFAAGTIDFAASLGVPAVARLVDNVWARFAAPQ* |
| Ga0134128_127205863 | 3300010373 | Terrestrial Soil | GAKVFAAGALNFGASLGSPDVERLLANVWTRLTVP* |
| Ga0134127_131055671 | 3300010399 | Terrestrial Soil | AAGAKVFAAGVLNFAASLGRPEVDRLLANVWARLSAP* |
| Ga0134122_130369952 | 3300010400 | Terrestrial Soil | AAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSVP* |
| Ga0134121_109140373 | 3300010401 | Terrestrial Soil | AGAKVFAAGVINFGASLQDPAVEPLLANVWARLIVP* |
| Ga0120167_10066946 | 3300012001 | Permafrost | RITRRRRGAKVFAAGALNFGASLGRPEVDRLLANVWARLSVP* |
| Ga0137382_101916394 | 3300012200 | Vadose Zone Soil | TYYETPTGAKVFAAGALNFGASLGRPQVDRLLANVWARLSVP* |
| Ga0137365_111218402 | 3300012201 | Vadose Zone Soil | AAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP* |
| Ga0137370_102732221 | 3300012285 | Vadose Zone Soil | TAAGAKVFAAGALNFGASVGDPVVARLLENVWARLSRP* |
| Ga0137366_101566784 | 3300012354 | Vadose Zone Soil | GAKVFAAGTLDFAASLDTPVVSRLVDNVWARLAAP* |
| Ga0137369_108182393 | 3300012355 | Vadose Zone Soil | YETPAGAKVFAAGSLNFSASLGRPEVERLLANVWARLSTP* |
| Ga0137369_111337461 | 3300012355 | Vadose Zone Soil | RSAEMTYYETAGSAKVFAAGTLNFAASLDRPDVSLLVDAVWAQLSVP* |
| Ga0137371_103439822 | 3300012356 | Vadose Zone Soil | EMTYYQTRAGAKIFSAGTINFGGSTQWPIAARLLDNLWARLSRP* |
| Ga0137371_110438251 | 3300012356 | Vadose Zone Soil | TAAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP* |
| Ga0157340_10195752 | 3300012473 | Arabidopsis Rhizosphere | TGSGARVFAAGVVNFVASINDPAVSRLVDNVWSRLAR* |
| Ga0157313_10283421 | 3300012503 | Arabidopsis Rhizosphere | TNAGARVFAAGVVNFAASINNPAVSRLVDNVWLRLAR* |
| Ga0157283_103012512 | 3300012907 | Soil | GAEVFAAGTLDFAASLDDPAVARLVENVWARLSKP* |
| Ga0157306_101794032 | 3300012912 | Soil | GARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR* |
| Ga0157302_105400461 | 3300012915 | Soil | PGGAKVFAAGALNFTASIGDPTVAQLVQNVWTRLSRP* |
| Ga0126375_106197372 | 3300012948 | Tropical Forest Soil | AGARVFAAGVVNFAASINNPAVSRLVDNVWSRLAR* |
| Ga0157369_113938391 | 3300013105 | Corn Rhizosphere | TGSGARVFAAGALDFAASITDPAVSRLVDNVWSRLAP* |
| Ga0157378_102718441 | 3300013297 | Miscanthus Rhizosphere | EMTYYEGGSGARVFAAGALDFTASITDPTVSRLVDNVWSRLAG* |
| Ga0182008_109220901 | 3300014497 | Rhizosphere | AGAKVFAAGVINFGASLADAQVDRLLENLWSRLAVP* |
| Ga0157376_106490831 | 3300014969 | Miscanthus Rhizosphere | YESASGARVFAAGALNFAASIGDPEVAQLVENVWTRLSVP* |
| Ga0167629_10420714 | 3300015209 | Glacier Forefield Soil | GAKVFAAGALNFGASLGLPEVERLLANVWARLSLP* |
| Ga0184621_100326951 | 3300018054 | Groundwater Sediment | ETPAGAKVFAAGVINFGASLGDTAVDRLLANLWARLTVP |
| Ga0184617_10967812 | 3300018066 | Groundwater Sediment | YETPAGAKVFAAGSLNFAASIGEPVVAQLVENLWTRLSGP |
| Ga0184618_100814023 | 3300018071 | Groundwater Sediment | GAKVFAAGALNFGASLGRPEVDRLLANVWTRLSVP |
| Ga0184635_101508551 | 3300018072 | Groundwater Sediment | YYETPGGAKVFAAGALNFTASIGDPTVSQLVENVWTRLSVP |
| Ga0190269_104112241 | 3300018465 | Soil | AGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP |
| Ga0190268_111413703 | 3300018466 | Soil | TYYETPAGAKVFAAGVLNFAASIDDPHVSRLVDNVWARLSRPA |
| Ga0066662_122777871 | 3300018468 | Grasslands Soil | TYYETPAGAKVFAAGALDFAASLDQPAVSRLVENLWTRLARP |
| Ga0066669_104986131 | 3300018482 | Grasslands Soil | QRGAKLFAGGALNFAVSVTQPAVAQLLNNVWARLSRP |
| Ga0066669_120924352 | 3300018482 | Grasslands Soil | ETAAGAKVFAAGALNFAASVDDPVVARLLDNVWARLTRP |
| Ga0184644_16101471 | 3300019269 | Groundwater Sediment | AGAKVFAAGALNFAASLGRPEVDRLLANVWARLGVP |
| Ga0210378_100954023 | 3300021073 | Groundwater Sediment | TPHGAKVFAAGALNFTASIGEPFVSQLVENVWARLSRP |
| Ga0222623_102267982 | 3300022694 | Groundwater Sediment | TPAGARVFAAGVVDFAASINDPAVSRLVENVWSRLTAR |
| Ga0247745_10357271 | 3300022898 | Soil | MTYYQRRGAKVFAAGTLNFAASIGNPTVAQLVENVWARLSQP |
| Ga0247745_10374452 | 3300022898 | Soil | SAGAKVFAAGALNFAASVDQPVVSQLLENLWGRLSLP |
| Ga0207654_103100793 | 3300025911 | Corn Rhizosphere | SGAKVFAAGALNFAASLGSPEVDRLLANVWARLTVP |
| Ga0207695_108954742 | 3300025913 | Corn Rhizosphere | YESASGARVFAAGALNFAASITDPAVSRLVENVWARLAR |
| Ga0207646_104010402 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YYETPAGAKVFAAGALNFAASVDDPVVARLLDNVWARLSRP |
| Ga0207650_115528491 | 3300025925 | Switchgrass Rhizosphere | AGAKVFAAGVLNFAASIDDPQVSRLVDNVWTRLSRST |
| Ga0207687_111926831 | 3300025927 | Miscanthus Rhizosphere | TPEGAKVFAAGAINFGASLADPAVDRLLSNVWARLTVP |
| Ga0207667_116439591 | 3300025949 | Corn Rhizosphere | YYESTSGARVFAAGALNFAASITDPAVSRLVENVWARLAR |
| Ga0208777_10188752 | 3300025996 | Rice Paddy Soil | ETGSGARVFAAGALNFTASITDPAVSRLVENVWSRLAR |
| Ga0207702_104567153 | 3300026078 | Corn Rhizosphere | SPSGARVFAAGTLDFTASITDPAVSQLVQNVWTRLAR |
| Ga0209806_13170422 | 3300026529 | Soil | GAKVFAAGALNFAASLGNEQVARLVENVWNKLTVP |
| Ga0207428_101110341 | 3300027907 | Populus Rhizosphere | YYETPAGARVFSAGAVNFAASIRDPAVSRLVENVWARLLGR |
| Ga0307291_10398881 | 3300028707 | Soil | EADSGARVFAAGALNFTASITDPAVSPLVENVWARLAR |
| Ga0307293_100406391 | 3300028711 | Soil | YETPAGARVFAAGALNFAASIGDPKVSQLVENVWTRLSRP |
| Ga0307285_101509501 | 3300028712 | Soil | YETAAGAKVFAAGALNFGASVGDPVVARILDNLWARLSRP |
| Ga0307313_101640462 | 3300028715 | Soil | GARVFAAGVVNFAASITDPAVSQLVDNVWSRLTEP |
| Ga0307311_101282542 | 3300028716 | Soil | SGARVFAAGALNFTASITDPAVSRLVENVWARLAR |
| Ga0307301_100273071 | 3300028719 | Soil | YETEAGARVFAAGVVNFAASITDPAVSQLVDNVWSRLTEP |
| Ga0307306_102075181 | 3300028782 | Soil | TAAGAKVFAAGALNFAASLGRPEVDRLLANVWARLSIP |
| Ga0307306_102716251 | 3300028782 | Soil | PAGAKVFAAGVINFGASLGDTAVDRLLANLWARLTVP |
| Ga0307290_101880462 | 3300028791 | Soil | EGPAGARVFAAGVLNFAASITDPSVSRLVDNVWSRLVR |
| Ga0307299_100814572 | 3300028793 | Soil | AGARVFAAGVVDFAASINDPAVSRLVENVWSRLTAR |
| Ga0307284_101943831 | 3300028799 | Soil | PAGARVFAAGALNFAASIGDPKVSQLVENVWTRLSRP |
| Ga0307305_103484753 | 3300028807 | Soil | YETPAGAKVFAAGALNFGASLGQPEVDRLLANVWARLSVP |
| Ga0307310_101179913 | 3300028824 | Soil | YETPEGAKVFAAGVINFGASLAQPAVDRLLTNVWSRLTVP |
| Ga0307286_102855781 | 3300028876 | Soil | YYETPAGAKVFAAGALNFAASVDQPVVSQLLENLWASLSLP |
| Ga0307277_100293671 | 3300028881 | Soil | YYENPRGAKVFAAGALNFAASIDHPAVAQLLDNVWARLSRP |
| Ga0307308_102297813 | 3300028884 | Soil | PAGAKVFAAGALNFGASLGRPEVDRLLANVWARLSIP |
| Ga0214472_114223051 | 3300033407 | Soil | TYYETPAGAKVFAAGVLNFAASIDDPQVSRLVENVWARLASR |
| Ga0247829_103561041 | 3300033550 | Soil | YYETPVGAKVFAAGALNFTASIGDPAVEGLVENVWSRLSRP |
| ⦗Top⦘ |