 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F095289 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGAAKS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.50 % |
| % of genes near scaffold ends (potentially truncated) | 6.67 % |
| % of genes from short scaffolds (< 2000 bps) | 6.67 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (92.381 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.524 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03061 | 4HBT | 62.86 |
| PF00440 | TetR_N | 6.67 |
| PF14539 | DUF4442 | 5.71 |
| PF00561 | Abhydrolase_1 | 0.95 |
| PF13185 | GAF_2 | 0.95 |
| PF04397 | LytTR | 0.95 |
| PF12867 | DinB_2 | 0.95 |
| PF01545 | Cation_efflux | 0.95 |
| PF01047 | MarR | 0.95 |
| PF07690 | MFS_1 | 0.95 |
| PF12697 | Abhydrolase_6 | 0.95 |
| PF00916 | Sulfate_transp | 0.95 |
| PF02321 | OEP | 0.95 |
| PF02417 | Chromate_transp | 0.95 |
| PF00109 | ketoacyl-synt | 0.95 |
| PF01740 | STAS | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF02397 | Bac_transf | 0.95 |
| PF00571 | CBS | 0.95 |
| PF14417 | MEDS | 0.95 |
| PF04055 | Radical_SAM | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.95 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.95 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.95 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 92.38 % |
| All Organisms | root | All Organisms | 7.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005178|Ga0066688_10246403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1143 | Open in IMG/M |
| 3300005518|Ga0070699_100563231 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300012208|Ga0137376_11357686 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026331|Ga0209267_1257545 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300026557|Ga0179587_10503180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300027908|Ga0209006_10001575 | All Organisms → cellular organisms → Bacteria | 20719 | Open in IMG/M |
| 3300031962|Ga0307479_10547937 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300032898|Ga0335072_10712076 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002528092 | 3300002245 | Forest Soil | MVSRLQKKEEARDFAVRHLEEYLETQVRMRKSKAGADKS* |
| JGI25388J43891_10740292 | 3300002909 | Grasslands Soil | FMVTRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS* |
| Ga0066674_103526882 | 3300005166 | Soil | FMVTRLQRNEEPLDLACHHLEEYLETKVRARKSKGRARNS* |
| Ga0066672_102564742 | 3300005167 | Soil | GSIMVSRLQKKEEPRDLAVLHLEEYLESRVRAQKSRLSTV* |
| Ga0066688_102464031 | 3300005178 | Soil | STLEGSIMVSRLQKKEEPRDLAVLHLEEYLETRVRARKSRGSTA* |
| Ga0066686_105660351 | 3300005446 | Soil | MVSRLQKKEGPRDLAVRHLEEYLETGVRARKSKAGAAKS* |
| Ga0066689_109265941 | 3300005447 | Soil | LEGSLMVSRLQRKDDPLDLACRHLEEYLEIKVRARKSKAGASKL* |
| Ga0070706_1007069343 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FMVSRLQRNEEPLNLACHHLEEYLETKVRARKPKGGARNS* |
| Ga0070698_1016192681 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | STLEGSFMVSRLQRNEEPLNLACHHLEEYLETKVRARKPKGGAPNS* |
| Ga0070699_1005632311 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TLEGSIMVSRLQKKEEPRDLAVRHLEEYLETKVRSRKSKAGAAKS* |
| Ga0070732_107967631 | 3300005542 | Surface Soil | QRKDDPLDLACRHLEAYLETKVRARRSKAGVDKS* |
| Ga0066692_104818943 | 3300005555 | Soil | LEGSLMVSRLQRNGDPLDLACRHLEEYLETKVRARQSKPEVDKS* |
| Ga0070762_102282063 | 3300005602 | Soil | SRLQKKDEPRDLAIRHLEEYLETAVRARKSKAGAHKP* |
| Ga0070762_104337161 | 3300005602 | Soil | MIRRLQKKDGPLDLACHHLEEHLETKVRARQSKTGGDNS* |
| Ga0066903_1035729671 | 3300005764 | Tropical Forest Soil | EGSFMVTRLQRNEEPLNLACDHLEEYLETKIRPRKSKSGARNS* |
| Ga0070766_106142263 | 3300005921 | Soil | LQKKEEPRDLAVRHLEEYLETRVRAWKAKAGADKS* |
| Ga0070717_103186423 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSRLQRNDEPLDLACRHLEEYLETKVRARQSKGGVGKS* |
| Ga0079222_117651633 | 3300006755 | Agricultural Soil | LEGSIMIRRLQKKDGPLDLACHHLEEHLETKVRARRSKLGTRK* |
| Ga0066658_105053961 | 3300006794 | Soil | SSFMLTRLQRDEEPLHLTCPHLEEYLETKVRARKSKGGARNS* |
| Ga0073928_107522083 | 3300006893 | Iron-Sulfur Acid Spring | LQRNKEPLDLACRHLEEYLETKVRARKSKAGADKS* |
| Ga0099795_101331721 | 3300007788 | Vadose Zone Soil | SSMLGRLQRKDEPLDLACHHLEEYLEDKVRAQKSNAT* |
| Ga0099830_103524653 | 3300009088 | Vadose Zone Soil | LQRNGDPLDLACRHLEEYLETKVRARQSKAGEDKS* |
| Ga0099830_103833583 | 3300009088 | Vadose Zone Soil | RLQKKEEPRDLAVRHLEEYLETKVRARKSKAGAAKS* |
| Ga0126384_110075493 | 3300010046 | Tropical Forest Soil | FMVTRLQRNEEPLNLACDHLEEYLETKVRARKPKSGARNS* |
| Ga0126373_103682751 | 3300010048 | Tropical Forest Soil | SFMVTRLQRNEEALNLACHHLEEYLETKVRARKPKGGARNS* |
| Ga0126373_104902321 | 3300010048 | Tropical Forest Soil | LEGSFMVSRLQRNEEPLNLACHHLEEYLETKVRAQQSKVRADKS* |
| Ga0134088_1000197612 | 3300010304 | Grasslands Soil | MVSHLQRKDGPLDLACRHLEEYLDTKVRAQESKARGDK* |
| Ga0134080_102132652 | 3300010333 | Grasslands Soil | SFMVSRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS* |
| Ga0126370_101895923 | 3300010358 | Tropical Forest Soil | EGSFMVTRLQRNEGPLNLACDHLEEYLETKVRARKSKAVVRKS* |
| Ga0126378_109465563 | 3300010361 | Tropical Forest Soil | LQRNEEALNLACHHLEEYLETKVRARKSKAVVRKS* |
| Ga0126378_114944392 | 3300010361 | Tropical Forest Soil | FMVTRLQRNEEPLNLACDHLEEYLETKVRARKFKSGARNS* |
| Ga0126378_117334991 | 3300010361 | Tropical Forest Soil | TRLQRNEEPLNLACDHLEEYLETKVRARKSKSGASNS* |
| Ga0126381_1010426063 | 3300010376 | Tropical Forest Soil | TLEGSFMVTRLQRNEEPLNLACDHLEEYLETKVRARKSKSGARNS* |
| Ga0150983_107247721 | 3300011120 | Forest Soil | VSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGADKP* |
| Ga0150983_166858962 | 3300011120 | Forest Soil | SIRVSRLQKKEEPRDLAVRHLEEYLETWVRARKSKEGAYKS* |
| Ga0137392_107094772 | 3300011269 | Vadose Zone Soil | VMIRRLQKKDGPLDLACHHLEEYLETKVRARQAEAGVHKS* |
| Ga0137388_119810931 | 3300012189 | Vadose Zone Soil | IMVSRLQKKEEPRDLAVRHLEEYLETGVRSRKSKAGATKS* |
| Ga0137363_105268341 | 3300012202 | Vadose Zone Soil | EGSVMIRRLQKKDGPLDLACHYLEEYLETKVRARQLKAGKDKS* |
| Ga0137376_113576862 | 3300012208 | Vadose Zone Soil | IASTLEGSFMVSRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS* |
| Ga0137384_105832861 | 3300012357 | Vadose Zone Soil | IMVSRLQKKEEPRDLAVRHLEDYLESRVRGQKSRGSTAKS* |
| Ga0137360_113923762 | 3300012361 | Vadose Zone Soil | VSRLQKKEGPRDLAVRHLEEYLETGVRSRKSKAGATKS* |
| Ga0137359_113808821 | 3300012923 | Vadose Zone Soil | MVTRLQRNEEPLNLACHHLEEYLETKVRARTSKGGTRN* |
| Ga0137359_113969662 | 3300012923 | Vadose Zone Soil | LEGSHMVSRLQRKEEPLDLACCHLEEYLETQVRARKSKARADKS* |
| Ga0137419_102072763 | 3300012925 | Vadose Zone Soil | TLEGSFMIRRLQKNDGPLDLACHHLEEYLETKVRARQAKAGADKS* |
| Ga0137416_112978801 | 3300012927 | Vadose Zone Soil | GSIMVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGADKS* |
| Ga0126369_120443302 | 3300012971 | Tropical Forest Soil | FMVSRLQRNEEPLNLACHHLEEYLDTKVRARKSKGGARNS* |
| Ga0164307_107748071 | 3300012987 | Soil | TLEGSIMVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGAAKS* |
| Ga0137412_100763771 | 3300015242 | Vadose Zone Soil | SMVSRLQRKDEPLDLACHHLEEYLEDKVRTQKSKAT* |
| Ga0193707_10067494 | 3300019881 | Soil | MVSRLQRNDAPLDLACGHLEEYLEAKVRAQQSRAGVDKS |
| Ga0193751_11082221 | 3300019888 | Soil | LEGSIMLSRLQKEEEPRDLAVRHLEEYLETKVRARKSKAGADKS |
| Ga0210399_106144813 | 3300020581 | Soil | MLSRLQKKEEPRDLAVRHLEEYLETGVRARKSKAGAAKS |
| Ga0210395_114002832 | 3300020582 | Soil | LQKKEEPRDLAVRHLEEYLETKVRARKSKAGAPKS |
| Ga0215015_100937462 | 3300021046 | Soil | MIRRLQKKDGPLDLACHHLEEHLETKVRARQSKVGARKS |
| Ga0210388_102699213 | 3300021181 | Soil | LEGSIMVSRLQKKDEARDLAIRHLEEYLETAVRARKSKAGAHQP |
| Ga0210386_102764331 | 3300021406 | Soil | VSRLQRNKEPLDLACRHLEEYLETKVRARKSRTGADKS |
| Ga0210386_107054331 | 3300021406 | Soil | SRLQKKDEPLLFACRHLEEYLEMKVRAGSSKRAKRP |
| Ga0210384_103303651 | 3300021432 | Soil | SRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGASKS |
| Ga0126371_113306921 | 3300021560 | Tropical Forest Soil | GSFMVTRLQRNEEPLNLACDHLEEYLETKVRARKFKSGARNS |
| Ga0242656_10316681 | 3300022525 | Soil | LQRNEEPLNLACHHLEEYLETKVRARKPKGGARNS |
| Ga0212123_101468403 | 3300022557 | Iron-Sulfur Acid Spring | SRLQRKEEPLDLACRHLEEYLETEVRARKSKARADKS |
| Ga0212123_106144461 | 3300022557 | Iron-Sulfur Acid Spring | LQRNKEPLDLACRHLEEYLETKVRARKSKAGADKS |
| Ga0242653_10001881 | 3300022712 | Soil | MVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGADKP |
| Ga0242657_11623081 | 3300022722 | Soil | LEGSIMVSRLQKKEEPLDLAVRHLEEYLDTKVRGRKSKAGAGKS |
| Ga0233357_10269091 | 3300023056 | Soil | ISRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGADKP |
| Ga0207699_104646751 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TLEGRIMVSRLQKKEEPRDLAVRHLEEYLDTKVRARKSKAGVGKS |
| Ga0207684_108519852 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FMVSRLQRNEEPLNLACHHLEEYLETKVRARKPKGGARNS |
| Ga0207700_108781562 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FMLTRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS |
| Ga0209761_11550702 | 3300026313 | Grasslands Soil | MVSHLQRKDGPLDLACRHLEEYLDTKVRAQESKARGDK |
| Ga0209267_12575452 | 3300026331 | Soil | LIASTLEGSFMVSRLQRNEEPLNLACHHLEEYLETKVRARKLKGGARNS |
| Ga0257170_10250491 | 3300026351 | Soil | MVTRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS |
| Ga0257181_10879242 | 3300026499 | Soil | TLEGSIMVSRLQKKEEPRDLAVRHLEEYLETGVRSRKSKAGATKS |
| Ga0209157_12419872 | 3300026537 | Soil | MVSRLQKKEGPRDLAVRHLEEYLETGVHARKSKAGAAKS |
| Ga0209648_106613792 | 3300026551 | Grasslands Soil | VQRNKEPLDLACHHLEEYLETRVRARKPKAGADKS |
| Ga0179587_105031801 | 3300026557 | Vadose Zone Soil | STLEGSVMIRRLQKKDGPLDLACDHLEEYLETKVRVRQSKAGVDKS |
| Ga0209010_10978001 | 3300027370 | Forest Soil | EGSLMVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGADKS |
| Ga0209179_10309191 | 3300027512 | Vadose Zone Soil | SSMLGRLQRKDEPLDLACHHLEEYLEDKVRAQKSNAT |
| Ga0209735_11225022 | 3300027562 | Forest Soil | RLQRNKEPLDLACRHLEEYLETKVRARKAKAGADKS |
| Ga0209733_10009221 | 3300027591 | Forest Soil | EGSIMVSRLQKKEEPRDLAVRHLEEYLETKVRARKAKAGADKS |
| Ga0209330_10009481 | 3300027619 | Forest Soil | LQRNKKPLDLACRHLEEYLETKVRARKLRTGADKP |
| Ga0209009_11995082 | 3300027667 | Forest Soil | SLMVSRLQRKDHPLDLACHHLEEYLETKVRARQSKAGMHKS |
| Ga0209773_101233132 | 3300027829 | Bog Forest Soil | GSHMMSRLQKKEEPRDLAARHLEEYLETKVRARKSKARS |
| Ga0209180_102915253 | 3300027846 | Vadose Zone Soil | TLEGSLMVSRLQRNGDPLDLACHHLEEYLETKVRVPRAKAGADKS |
| Ga0209380_104672231 | 3300027889 | Soil | RLQKKEEPRDLAVRHLEEYLETRVRAWKAKAGADKS |
| Ga0209006_1000157514 | 3300027908 | Forest Soil | MVSRLQKKEEARDFAVRHLEEYLETQVRMRKSKAGADKS |
| Ga0311340_105344334 | 3300029943 | Palsa | IRRLQKKDGPLDLACDHLDEYLEAKVRARRSKAKVDES |
| Ga0311354_109423271 | 3300030618 | Palsa | SRLQKKEEPRDLAVHHLEEYLETKVRAQKAKAGVHKS |
| Ga0170818_1137824942 | 3300031474 | Forest Soil | VSRLQKKEEPRHLAVRHLEEYLETKVRSRKSKAGATKS |
| Ga0318541_103534152 | 3300031545 | Soil | LEGSFMVSRLQRNEEPLNVACHRLEEYLETKVRARKSKGGARNS |
| Ga0318561_107216971 | 3300031679 | Soil | LEGSFMVTRLQRNEESLNLACDHLEEYLETKVRARKSKSGARNS |
| Ga0307477_101039251 | 3300031753 | Hardwood Forest Soil | VSRLQRKEEPLDLACRHLEKYLETEVRARKSKAGADKS |
| Ga0307475_100666551 | 3300031754 | Hardwood Forest Soil | LQKKEEPRDLAVRHLEEYLETNVRSRKSKAGTTKS |
| Ga0318523_105328551 | 3300031798 | Soil | LEGSFMVSRLQRNEEPLNLACHHLEEYLETKVRARKSKAGARNS |
| Ga0307478_108427792 | 3300031823 | Hardwood Forest Soil | MVSRLQKKEEPRDLAVRHLEEYLETKVRARKSKAGAAKS |
| Ga0307478_112054731 | 3300031823 | Hardwood Forest Soil | EGSFMLTRLQRNEEPLNLACHHLEEYLETKVRARKSKGGARNS |
| Ga0306919_113949681 | 3300031879 | Soil | EGSFMVSRLQRNEEPLNLACHHLEEYLETKVRARKSKAGARNS |
| Ga0310909_1001177411 | 3300031947 | Soil | EGSFMMTRLQRNEAPLNLACDHLEEYLETKVRARKSKSGARNS |
| Ga0306926_119109391 | 3300031954 | Soil | SRLQRSEEPLNLACHHLEEYLETKVRAEKSKGGARNS |
| Ga0306926_125280642 | 3300031954 | Soil | SRLQRNEEPLNLACHHLEEYLETKVRARKSKAGARNS |
| Ga0307479_105479371 | 3300031962 | Hardwood Forest Soil | LEGSHMVSRLQRKEEPLDLACRHLEKYLETEVRARKSKAGADKS |
| Ga0318533_107111141 | 3300032059 | Soil | LQRNEEPLNLACDHLEEYLETKVRARKSKSGARNSCAQGIPL |
| Ga0306924_118969321 | 3300032076 | Soil | LSGLQRQQDPLNLACRHLEEYLETKVRARKQKTGAGRS |
| Ga0307471_1013492061 | 3300032180 | Hardwood Forest Soil | GSFMVSRLQRNEEPLNLACHHLEEYLETKVCMRKSKSGARNS |
| Ga0307472_1008891993 | 3300032205 | Hardwood Forest Soil | RLKKNDGPLDLACHHLEEYLETKVRARQAKAGVDKS |
| Ga0348332_116083752 | 3300032515 | Plant Litter | MVSRLQRNKKPLDLACHHLEEYLETKVRARKSKTGADKS |
| Ga0335072_107120763 | 3300032898 | Soil | STLEGSLMVSRLQRERNPLDLACRHLEDYLETKVRAPKSKTTMERL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |