NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095261

Metagenome / Metatranscriptome Family F095261

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095261
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 44 residues
Representative Sequence MKRQLVTAAALFALAATAVGAVQVTAQDSRVVCIPPAVIQALS
Number of Associated Samples 92
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.24 %
% of genes near scaffold ends (potentially truncated) 17.14 %
% of genes from short scaffolds (< 2000 bps) 79.05 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.238 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(41.905 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.286 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.70%    β-sheet: 0.00%    Coil/Unstructured: 49.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13417GST_N_3 26.67
PF00126HTH_1 24.76
PF02798GST_N 19.05
PF03466LysR_substrate 14.29
PF02900LigB 5.71
PF01769MgtE 0.95
PF02253PLA1 0.95
PF01264Chorismate_synt 0.95
PF04909Amidohydro_2 0.95
PF13343SBP_bac_6 0.95
PF00571CBS 0.95
PF13409GST_N_2 0.95
PF003936PGD 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 0.95
COG03626-phosphogluconate dehydrogenaseCarbohydrate transport and metabolism [G] 0.95
COG10236-phosphogluconate dehydrogenase (decarboxylating)Carbohydrate transport and metabolism [G] 0.95
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 0.95
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.95
COG2829Outer membrane phospholipase ACell wall/membrane/envelope biogenesis [M] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.24 %
UnclassifiedrootN/A24.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002906|JGI25614J43888_10000388All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria12106Open in IMG/M
3300002907|JGI25613J43889_10000832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales7537Open in IMG/M
3300002908|JGI25382J43887_10461062All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300003321|soilH1_10058768All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1048Open in IMG/M
3300004463|Ga0063356_103904327All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300004803|Ga0058862_12628273Not Available839Open in IMG/M
3300005172|Ga0066683_10299778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria999Open in IMG/M
3300005175|Ga0066673_10745652All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300005175|Ga0066673_10809868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria535Open in IMG/M
3300005176|Ga0066679_10356245All Organisms → cellular organisms → Bacteria → Proteobacteria957Open in IMG/M
3300005178|Ga0066688_10080422All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1955Open in IMG/M
3300005187|Ga0066675_11045813Not Available612Open in IMG/M
3300005330|Ga0070690_101386913All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300005436|Ga0070713_101864648All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300005447|Ga0066689_10113070All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1574Open in IMG/M
3300005454|Ga0066687_10106254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1425Open in IMG/M
3300005471|Ga0070698_100174116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2092Open in IMG/M
3300005518|Ga0070699_100022699All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales5408Open in IMG/M
3300005518|Ga0070699_100768851All Organisms → cellular organisms → Bacteria → Proteobacteria881Open in IMG/M
3300005540|Ga0066697_10043770All Organisms → cellular organisms → Bacteria → Proteobacteria2522Open in IMG/M
3300005545|Ga0070695_101821459Not Available511Open in IMG/M
3300005556|Ga0066707_10194739All Organisms → cellular organisms → Bacteria → Proteobacteria1306Open in IMG/M
3300005560|Ga0066670_11045991Not Available500Open in IMG/M
3300005561|Ga0066699_10117660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1776Open in IMG/M
3300005566|Ga0066693_10067607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1232Open in IMG/M
3300005615|Ga0070702_101100372All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria635Open in IMG/M
3300005985|Ga0081539_10000443All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria88031Open in IMG/M
3300006031|Ga0066651_10595609All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria588Open in IMG/M
3300006032|Ga0066696_10355084All Organisms → cellular organisms → Bacteria → Proteobacteria955Open in IMG/M
3300006032|Ga0066696_10443115All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria850Open in IMG/M
3300006791|Ga0066653_10482924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum628Open in IMG/M
3300006800|Ga0066660_11676552Not Available506Open in IMG/M
3300006806|Ga0079220_11319571All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria606Open in IMG/M
3300006854|Ga0075425_100526219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1361Open in IMG/M
3300006854|Ga0075425_100601298All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1265Open in IMG/M
3300006854|Ga0075425_101429700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria782Open in IMG/M
3300006871|Ga0075434_101332224Not Available728Open in IMG/M
3300006903|Ga0075426_10000756All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria22500Open in IMG/M
3300006904|Ga0075424_100378276All Organisms → cellular organisms → Bacteria → Proteobacteria1509Open in IMG/M
3300006914|Ga0075436_101311674All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300009012|Ga0066710_100696959All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae1548Open in IMG/M
3300009089|Ga0099828_11082464All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300009137|Ga0066709_102666738All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300009143|Ga0099792_10024732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2721Open in IMG/M
3300010337|Ga0134062_10402624Not Available670Open in IMG/M
3300010396|Ga0134126_13002512Not Available510Open in IMG/M
3300010403|Ga0134123_11538968All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300011270|Ga0137391_10721537Not Available827Open in IMG/M
3300012206|Ga0137380_10704254All Organisms → cellular organisms → Bacteria → Proteobacteria877Open in IMG/M
3300012212|Ga0150985_104038449All Organisms → cellular organisms → Bacteria → Proteobacteria1098Open in IMG/M
3300012212|Ga0150985_115613571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum578Open in IMG/M
3300012212|Ga0150985_118169282Not Available559Open in IMG/M
3300012212|Ga0150985_118723807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum592Open in IMG/M
3300012363|Ga0137390_10313315All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1551Open in IMG/M
3300012469|Ga0150984_108446940Not Available516Open in IMG/M
3300012685|Ga0137397_11281965All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria522Open in IMG/M
3300012922|Ga0137394_10541476All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales987Open in IMG/M
3300012923|Ga0137359_10035448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4300Open in IMG/M
3300012929|Ga0137404_10000356All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria29768Open in IMG/M
3300012961|Ga0164302_10733949Not Available736Open in IMG/M
3300015245|Ga0137409_10830468All Organisms → cellular organisms → Bacteria → Proteobacteria759Open in IMG/M
3300017654|Ga0134069_1343604All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria536Open in IMG/M
3300017656|Ga0134112_10488157Not Available520Open in IMG/M
3300018433|Ga0066667_11431450Not Available608Open in IMG/M
3300018468|Ga0066662_11458279Not Available710Open in IMG/M
3300018482|Ga0066669_10097583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2031Open in IMG/M
3300018482|Ga0066669_10393294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1170Open in IMG/M
3300018482|Ga0066669_12190418All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300019789|Ga0137408_1079770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae4955Open in IMG/M
3300020202|Ga0196964_10002112All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9650Open in IMG/M
3300024219|Ga0247665_1033928All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300024284|Ga0247671_1082512All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300024290|Ga0247667_1018811All Organisms → cellular organisms → Bacteria → Proteobacteria1344Open in IMG/M
3300024347|Ga0179591_1044634All Organisms → cellular organisms → Bacteria → Proteobacteria1725Open in IMG/M
3300025898|Ga0207692_10677084Not Available668Open in IMG/M
3300025905|Ga0207685_10513001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300025912|Ga0207707_11218401All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300025939|Ga0207665_10222406All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1384Open in IMG/M
3300026304|Ga0209240_1010147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3571Open in IMG/M
3300026305|Ga0209688_1024330All Organisms → cellular organisms → Bacteria → Proteobacteria1173Open in IMG/M
3300026316|Ga0209155_1224350All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300026318|Ga0209471_1135154All Organisms → cellular organisms → Bacteria → Proteobacteria1036Open in IMG/M
3300026319|Ga0209647_1159646Not Available926Open in IMG/M
3300026319|Ga0209647_1312445All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300026320|Ga0209131_1011806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5404Open in IMG/M
3300026327|Ga0209266_1292328All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria513Open in IMG/M
3300026331|Ga0209267_1130690All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300026527|Ga0209059_1062959All Organisms → cellular organisms → Bacteria → Proteobacteria1610Open in IMG/M
3300026530|Ga0209807_1033121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2474Open in IMG/M
3300026538|Ga0209056_10604743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria553Open in IMG/M
3300026548|Ga0209161_10405351Not Available599Open in IMG/M
3300026550|Ga0209474_10596716Not Available564Open in IMG/M
3300026550|Ga0209474_10609172Not Available559Open in IMG/M
3300027748|Ga0209689_1025697All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3568Open in IMG/M
3300027903|Ga0209488_10015241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5598Open in IMG/M
3300031481|Ga0314816_1027185Not Available725Open in IMG/M
3300031548|Ga0307408_102347245All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300031720|Ga0307469_11667532All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales614Open in IMG/M
3300032002|Ga0307416_101341315All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M
3300032770|Ga0335085_12392622Not Available526Open in IMG/M
3300033412|Ga0310810_11006355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum711Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil13.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.90%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.95%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.95%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.95%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300031481Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25614J43888_1000038833300002906Grasslands SoilMKRQLVTAAALLALAATALAGVHATTQEAHIVCIPPAVIQALS*
JGI25613J43889_1000083293300002907Grasslands SoilMKRQLVTAGALLALAATALAGVHATTQEAHIVCIPPAVIQALS*
JGI25382J43887_1046106223300002908Grasslands SoilMKRQLVTAAALLALAVTALGAVQVTAADSRVVCIPPAVIQALS*
soilH1_1005876813300003321Sugarcane Root And Bulk SoilMWLKKSLITGAAIAALGATALGAVQVTAPGAGVVCLPPAVVQAWS*
soilH1_1005876933300003321Sugarcane Root And Bulk SoilMLKRSVVTGVALAALVATGFAAVQVTAQGSRIVCLPPAVVQAWS*
Ga0055469_1001384113300003999Natural And Restored WetlandsMKRSLVTAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS*
Ga0063356_10390432723300004463Arabidopsis Thaliana RhizosphereMKKPFVTAAALTLLAATAFGAVQVTNSPRVVCIPPAVVQAWS*
Ga0058862_1262827323300004803Host-AssociatedMMKRQLVTAAAITMLAAAAFGAVQLTAHDARVVCIPPAVVQAWS*
Ga0066683_1029977823300005172SoilMKRQLVTAAALLALAVTALGAVQVTATDSRVVCIPPAVIQALS*
Ga0066673_1074565223300005175SoilMRRTLVTAAALASLVATAAGAVQVTASQARLVCLPPAVIQAWS*
Ga0066673_1080986823300005175SoilMKRQLVTAAALIALAATAFAGVHVTSQESHLVCIPPAVIHALS*
Ga0066679_1035624523300005176SoilMKRQLVTAAALLALALTALGAVQVTATDSRVVCIPPAVIQALS*
Ga0066688_1008042233300005178SoilMKRKLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS*
Ga0066675_1104581313300005187SoilKRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS*
Ga0070690_10138691323300005330Switchgrass RhizosphereMKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0070713_10186464823300005436Corn, Switchgrass And Miscanthus RhizosphereMKRQLVTVAALIALAATMLGAVQITDTERRAVCIPPAVVQAWS*
Ga0066689_1011307023300005447SoilMKRQLVTVAALLALAVTALGAVQVTAPDSRVVCIPPAVIQALS*
Ga0066687_1010625433300005454SoilMKRQLVTAAALIALAATALGAVHVTDTERSAVCIPPAVVQAWS*
Ga0070698_10017411613300005471Corn, Switchgrass And Miscanthus RhizosphereMKKHLITAAAFMLLAATAFGAVHVTDSSRVVCIPPAVVQAWS*
Ga0070699_10002269953300005518Corn, Switchgrass And Miscanthus RhizosphereMRRTLVTAAALVALAATALGAVHVTAPDGRSVCLPAPVIQAWS*
Ga0070699_10076885123300005518Corn, Switchgrass And Miscanthus RhizosphereMKKHLITAAALMLLAATAFGAVHVTDSSRVVCIPPAVVQAWS*
Ga0066697_1004377033300005540SoilMKRKLVTAAALIALAATAFAGVHATSQESHLVCIAPAVIHALS*
Ga0070695_10182145923300005545Corn, Switchgrass And Miscanthus RhizosphereMKRQLVTVAALIALAATALGAVRVTDTARSAVCIPPAVVQAWS*
Ga0066707_1019473923300005556SoilMKRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS*
Ga0066670_1104599113300005560SoilMRRTLVTAAALASLVATAAGAVRVTASQARLVCLPPAVIQAWS*
Ga0066699_1011766033300005561SoilMKRQLVTAAALIALAATAFAGIHATSQEPHIVCIPPAVIQALS*
Ga0066693_1006760733300005566SoilMKQILVSAAALLALAATAAGAVQITAQNARLVCLPPAVIQAWS*
Ga0070702_10110037213300005615Corn, Switchgrass And Miscanthus RhizosphereMKRQLVTVAALFALAATALGAVHVTAQERATVCIPPAVVQAWS*
Ga0081539_10000443873300005985Tabebuia Heterophylla RhizosphereMQRTLVTAAALLLLAVTGAGAVQLTALNAQVVCLPPAVIQAWS*
Ga0066651_1059560913300006031SoilMKRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS*
Ga0066696_1035508433300006032SoilRQLGSPMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0066696_1044311523300006032SoilMKRQLVTAAALLALAVTAVGAVQVTTTDSRVVCLPPAVIHALS*
Ga0066653_1048292413300006791SoilMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0066660_1167655233300006800SoilMRRTLVTATALASLVATAAGAVRVTASQARLVCLPPAVIQAWS*
Ga0079220_1131957123300006806Agricultural SoilMWLKKSLITGAAVAALGATALGAVQVTAPGARVVCLPPAVIQAWS*
Ga0075425_10052621923300006854Populus RhizosphereMKRQLITVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0075425_10060129813300006854Populus RhizosphereMRRVLVTVGALAALAATAAGAVHVTAPEARVVCLPPAVVQAWS*
Ga0075425_10142970013300006854Populus RhizosphereMRRTLVTAAALVTLAATALGAVQVTAPEARTVCLPAAVIQAWS*
Ga0075434_10133222423300006871Populus RhizosphereGSPMKRQLVTVAALIALAATALGAVRVTDTERSAICIPPAVVQAWS*
Ga0075426_10000756233300006903Populus RhizosphereLVTAAALVTLAATALGAVQVTAPEARTVCLPAAVIQAWS*
Ga0075424_10037827623300006904Populus RhizosphereLRQLGSPMKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0075436_10131167423300006914Populus RhizosphereMKRQLVTVAALIALAATALGAVQVTDTERSAVCIPPAVVQAWS*
Ga0066710_10069695923300009012Grasslands SoilMKRQLVTAAALLALAVTAVGAVQVTTTDSRVVCLPPAVIQALS
Ga0099828_1108246423300009089Vadose Zone SoilMKKQLVTAAALLALAVTAVGAVQVTAPDSHVVCIPPAVIPAVIQVLS*
Ga0066709_10266673823300009137Grasslands SoilMKRQLVTAAALIALAATALGAVHVTAQERSTVCIPPAVIKALS*
Ga0099792_1002473233300009143Vadose Zone SoilMKRQLVTAGALLALAATALAGVHATTQEPHIVCIPPAVILALS*
Ga0134062_1040262423300010337Grasslands SoilARNLRQIGSPMKRQLVTVAALIAMAATALGAVHVTEQERSTVCIPPAVIQALS*
Ga0134126_1300251223300010396Terrestrial SoilQTFAMKRFLVTGAVLAALAVVSISAVQVTTQESRAVCIPPAVVQAWS*
Ga0134123_1153896823300010403Terrestrial SoilMKRQLVTAAALIALAATALGAVHVTAQERATVCIPPAVIQALT*
Ga0137391_1072153723300011270Vadose Zone SoilMRKQHVTALALAALAAATLGAVQITAQDSHMVCIPPAVIQALS*
Ga0137380_1070425423300012206Vadose Zone SoilMKRQLVTAAALFALAATAVGAVQVTAQDSRVVCIPPAVIQALS*
Ga0150985_10403844913300012212Avena Fatua RhizosphereMRRTLVTAAALALLGATAAGAVQVTASDARLVCLPPAVIQAWS*
Ga0150985_11561357113300012212Avena Fatua RhizosphereIGSSMKRQLVTAAALFALAATALGAVHVTAQERATVCIPPAVVQAWS*
Ga0150985_11816928223300012212Avena Fatua RhizosphereMKRQLVTLAALFALAATALGAVHVTAQERASVCIPPAVVQAWS*
Ga0150985_11872380723300012212Avena Fatua RhizosphereMKRQLVTVAALIALTATGLGAVHVTEQERSTVCIPPAVIQALS*
Ga0137390_1031331523300012363Vadose Zone SoilMRKQLVTALALAALAAATLGAVQITAQDSHMVCIPPAVIQALS*
Ga0150984_10844694023300012469Avena Fatua RhizosphereFRSRGLRMKRTLVTAAALALFGATAAGAVQVTASDARLVCLPPAVIQAWS*
Ga0137397_1128196523300012685Vadose Zone SoilMKRQLITVAALIALAATALGAVHVTDTERRAVCIPPAVIQAWS*
Ga0137394_1054147633300012922Vadose Zone SoilMRRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS*
Ga0137359_1003544863300012923Vadose Zone SoilMKRQLITAGALLALAATALAGVHATTQEAHIVCIPPGVIQALS*
Ga0137404_10000356233300012929Vadose Zone SoilMKRQLVTVAALVALAATALGAVRVTAQERATVCIPPAVIQALS*
Ga0164302_1073394923300012961SoilAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS*
Ga0075316_122177213300014314Natural And Restored WetlandsTAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS*
Ga0137409_1083046823300015245Vadose Zone SoilMQLAAGETSMKRQLVTAAALLALAATALAGVHATTQEPHIVCIPPAVIQALS*
Ga0134069_134360413300017654Grasslands SoilMKRQLVTAAALFALAVTAVGAVQVTAQDARVVCIPPA
Ga0134112_1048815713300017656Grasslands SoilMKRQLVTAAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS
Ga0066667_1143145013300018433Grasslands SoilTLVTAAALASLVATAAGAVQVTASDARLVCLPPAVIQAWS
Ga0066662_1145827923300018468Grasslands SoilMKRTIVTAAALALLGATAAGAVQVTASEARLLCLPPAVIQAWS
Ga0066669_1009758323300018482Grasslands SoilMRRTLVTAAALASIVATAAGAVRVTASQARLVCLPPAVIQAWS
Ga0066669_1039329423300018482Grasslands SoilMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS
Ga0066669_1219041813300018482Grasslands SoilMKRQLVTAAALLALAVTALGAVQVTATDSHVVCIPPAVIQAL
Ga0137408_107977053300019789Vadose Zone SoilMKRQLVTVAALVALAATALGAVRVTAQERATVCIPPAVIQALS
Ga0196964_1000211273300020202SoilMKKGFITAVALAALAATAVGAVQVTTPDSVVRLPAAVIQALS
Ga0247665_103392823300024219SoilMKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS
Ga0247671_108251223300024284SoilMKRQLVTVAALIALAATALGAVQVTDTERSTVCIPPAVVQAWS
Ga0247667_101881113300024290SoilLRQIGSPMKRQLVTVAALFALAATALGAVQVTDTERSTVCIPPAVVQAWS
Ga0179591_104463433300024347Vadose Zone SoilMRRQLVTVAALIAMAATALGAVHVTEQERSTVCIPPAVIQALS
Ga0210114_101797143300025795Natural And Restored WetlandsMKRSLVTAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS
Ga0207692_1067708413300025898Corn, Switchgrass And Miscanthus RhizosphereKRQLVTVAALIALAATMLGAVQITDTERRAVCIPPAVVQAWS
Ga0207685_1051300123300025905Corn, Switchgrass And Miscanthus RhizosphereTCDRKSTHMKRTLVTAVALVALTATAFGAVQVTDQEGRAVCVPPAVIQALS
Ga0207707_1121840123300025912Corn RhizosphereMMKRQLVTAAAITMLAAAAFGAVQLTAHDARVVCIPPAVVQAWS
Ga0207665_1022240643300025939Corn, Switchgrass And Miscanthus RhizosphereMKRQLITVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS
Ga0209240_101014753300026304Grasslands SoilMKRQLVTAAALLALAATALAGVHATTQEAHIVCIPPAVIQALS
Ga0209688_102433033300026305SoilMKQILVSAAALLALAATAAGAVQITAQNARLVCLPPAVIQAWS
Ga0209155_122435023300026316SoilMKRQLVTAAALIALAATAFAGVHVTSQESHLVCIPPAVIHALS
Ga0209471_113515423300026318SoilMKRQLVTAAALLALALTALGAVQVTATDSRVVCIPPAVIQALS
Ga0209647_115964623300026319Grasslands SoilMRRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS
Ga0209647_131244513300026319Grasslands SoilMQLAAGETSMKRQLVTAGALLALAATALAGVHATTQEPHIVCIPPAVIQALS
Ga0209131_101180683300026320Grasslands SoilMKRQLVTAGALLALAATALAGVHATTQEPHIVCIPLAVIQALS
Ga0209266_129232823300026327SoilMKRQLVTAAALLALAVTALGAVQVTATDSRVVCIPPAVIQALS
Ga0209267_113069023300026331SoilMKRKLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS
Ga0209059_106295933300026527SoilMRRTLVTAAALASLVATAAGAVRVTASQARLVCLPPAVIQAWS
Ga0209807_103312123300026530SoilMKRKLVTAAALIALAATAFAGVHATSQESHLVCIAPAVIHALS
Ga0209056_1060474323300026538SoilMKRQLVTVAALLALAVTALGAVQVTAPDSRVVCIPPAVIQALS
Ga0209161_1040535123300026548SoilMQLAAGESSMKRQLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS
Ga0209474_1059671623300026550SoilKRQLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS
Ga0209474_1060917223300026550SoilRNLRQLGSPMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS
Ga0209689_102569713300027748SoilMKRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS
Ga0209488_1001524133300027903Vadose Zone SoilMKRQLVTAAALLALAATALAGVHATTQEPHIVCIPPAVILALS
Ga0314816_102718513300031481SoilMKRQLITAAALTALVAAAFGAVQVTAQDARTVCIPPAVVQAWS
Ga0307408_10234724523300031548RhizosphereMKKGLITAVALLALAVTAVGAVQVTTPGSVVEIPAAVIQAWS
Ga0307469_1166753223300031720Hardwood Forest SoilMKRQLVTVAALIALAATALGAVHVTESERSAVCIPPAVIQAWS
Ga0307416_10134131523300032002RhizosphereMKKGLITVVALLALAATAVGAVQVTTPGCVVEIPVAVIQAWS
Ga0335085_1239262213300032770SoilMKRQLVTVAALIALAATALGAVHVTSEERSALCIPPAVIQAWS
Ga0310810_1100635523300033412SoilMKRQWVTAAAIAMLAATAFGAVQVTAQDARVVCIPPAVVQAWS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.