| Basic Information | |
|---|---|
| Family ID | F095244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIDRVDKDVRAFISL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.67 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 95.24 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.905 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02686 | Glu-tRNAGln | 60.95 |
| PF05258 | DciA | 34.29 |
| PF03938 | OmpH | 0.95 |
| PF13084 | DUF3943 | 0.95 |
| PF05685 | Uma2 | 0.95 |
| PF01230 | HIT | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 60.95 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 34.29 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.14 % |
| Unclassified | root | N/A | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10009015 | All Organisms → cellular organisms → Bacteria | 3548 | Open in IMG/M |
| 3300003321|soilH1_10327727 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300004114|Ga0062593_100239971 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300004157|Ga0062590_102431307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 553 | Open in IMG/M |
| 3300004463|Ga0063356_100318972 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300004463|Ga0063356_101627492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 962 | Open in IMG/M |
| 3300004633|Ga0066395_10266070 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300004803|Ga0058862_12715000 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005093|Ga0062594_100180723 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005093|Ga0062594_102631873 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005180|Ga0066685_10040190 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300005337|Ga0070682_101456248 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005347|Ga0070668_100723706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300005353|Ga0070669_100221132 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300005447|Ga0066689_10757047 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005466|Ga0070685_10051963 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300005544|Ga0070686_101266224 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005558|Ga0066698_10480049 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005569|Ga0066705_10548092 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005576|Ga0066708_10628262 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005615|Ga0070702_101310479 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005713|Ga0066905_101115177 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005719|Ga0068861_102524488 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005836|Ga0074470_10429096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300005836|Ga0074470_11198114 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005840|Ga0068870_10977669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005843|Ga0068860_100581626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1124 | Open in IMG/M |
| 3300006049|Ga0075417_10420767 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006794|Ga0066658_10189414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300006797|Ga0066659_11809031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 517 | Open in IMG/M |
| 3300006844|Ga0075428_101392492 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006845|Ga0075421_100249146 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300006846|Ga0075430_100214471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300006852|Ga0075433_10833249 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006871|Ga0075434_101021451 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300009012|Ga0066710_102193362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300009012|Ga0066710_102447075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300009094|Ga0111539_12153464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300009098|Ga0105245_11330115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300009137|Ga0066709_104446268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 512 | Open in IMG/M |
| 3300009147|Ga0114129_10979899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300009162|Ga0075423_10469243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300009553|Ga0105249_11239251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300010048|Ga0126373_10517309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300010048|Ga0126373_11565720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300010086|Ga0127496_1052838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010323|Ga0134086_10131376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300010329|Ga0134111_10548927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010358|Ga0126370_10511267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300010360|Ga0126372_10777157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300010360|Ga0126372_12069354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300010366|Ga0126379_10926638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300010397|Ga0134124_11011538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300010399|Ga0134127_13455462 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010400|Ga0134122_11588620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010401|Ga0134121_10593779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300011440|Ga0137433_1315363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012039|Ga0137421_1241387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012202|Ga0137363_10998533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300012209|Ga0137379_10455832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300012211|Ga0137377_11567949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012357|Ga0137384_10717911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300012388|Ga0134031_1179088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300012469|Ga0150984_113935068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300012469|Ga0150984_115700305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012944|Ga0137410_11960586 | Not Available | 520 | Open in IMG/M |
| 3300012948|Ga0126375_10142194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300012948|Ga0126375_10677950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012948|Ga0126375_11411633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300012948|Ga0126375_12076090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Thermacetogenium → Thermacetogenium phaeum | 504 | Open in IMG/M |
| 3300012971|Ga0126369_13573831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300014320|Ga0075342_1178668 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015373|Ga0132257_100472471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1535 | Open in IMG/M |
| 3300016404|Ga0182037_11321900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300017656|Ga0134112_10401115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017657|Ga0134074_1407339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300017792|Ga0163161_11838004 | Not Available | 539 | Open in IMG/M |
| 3300017965|Ga0190266_11058434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300018074|Ga0184640_10172986 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300018079|Ga0184627_10422806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300019487|Ga0187893_10272652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300022756|Ga0222622_10294677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300025174|Ga0209324_10832155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300025941|Ga0207711_11380673 | Not Available | 647 | Open in IMG/M |
| 3300025960|Ga0207651_10043575 | All Organisms → cellular organisms → Bacteria | 2996 | Open in IMG/M |
| 3300025961|Ga0207712_10809125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300025972|Ga0207668_11078954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300026121|Ga0207683_11155265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300026121|Ga0207683_11668720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300026323|Ga0209472_1043091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1983 | Open in IMG/M |
| 3300026523|Ga0209808_1301946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300026538|Ga0209056_10189528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300027874|Ga0209465_10257929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300031740|Ga0307468_101664258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 599 | Open in IMG/M |
| 3300031847|Ga0310907_10650746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300031890|Ga0306925_11046444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300031908|Ga0310900_10830223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300031912|Ga0306921_12303210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031946|Ga0310910_11155273 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031954|Ga0306926_10685700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300032180|Ga0307471_103897870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300032205|Ga0307472_101279548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300032261|Ga0306920_100924865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300033289|Ga0310914_11358536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300034668|Ga0314793_077937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.95% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100090154 | 3300002558 | Grasslands Soil | MNLQNITADKLVGLYKNRDLTAIEVITSLYEDIERTDKDVHAFLSICRERALLSGYIRIAI* |
| soilH1_103277271 | 3300003321 | Sugarcane Root And Bulk Soil | MNLKNITAEKLVALYQNRDLTVTEVIKGVYEEIDRVDKDVRAFLALCPDRALEDAR |
| Ga0062593_1002399711 | 3300004114 | Soil | MNLKTITADKLVALYKNRDLTVTEVIMSVYEQIANVDQDVRAFLSLCPERA |
| Ga0062590_1024313071 | 3300004157 | Soil | MNLKGITTDKLVALYQKREASVTEVITSVFEEIHRTDKDVRAFLTLCPD |
| Ga0063356_1003189725 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNLKNITADKLVDLYYQREVSVTEVITSVFEEIERTDKDVRAFLTLCPDQALE |
| Ga0063356_1016274923 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNLKNITADKLVSLYKNKDLSVTEVISSTYEEIARTDAQIHAFISLTQERALGEARRMD |
| Ga0066395_102660703 | 3300004633 | Tropical Forest Soil | MNLRNITADKLVALYKNREISVTEVIKSVYEEIEKVDKDVRALLSICPDRALDE |
| Ga0058862_127150003 | 3300004803 | Host-Associated | MNLKNITADKLVALYRNRDLSVTEVIRSVYEEIERVDGDVR |
| Ga0062594_1001807231 | 3300005093 | Soil | MNLKSMTADKLVGLYRNHDLSVTEVIQSVFDEIERSDKNIRAFL |
| Ga0062594_1026318731 | 3300005093 | Soil | MNLKNMTADRLVGLYRNHDLSVTEVIRSVFDEIERNDKNIHAFLTLCKDRA |
| Ga0066685_100401901 | 3300005180 | Soil | MNLRNITADKLVALYQNRDLSASEVITSVYDEIERRDKEVHAFLSNCRERALEEARRMD |
| Ga0070682_1014562483 | 3300005337 | Corn Rhizosphere | MNLKNITADKLVAMYAKRDLSVTEVLNGVFEEIDRSDKNIRAFITVCRESAL |
| Ga0070668_1007237061 | 3300005347 | Switchgrass Rhizosphere | MNLKNMTADKLVGLYRNHDLSVTEVIRSVFDEIDRNDQSIHA |
| Ga0070669_1002211324 | 3300005353 | Switchgrass Rhizosphere | MNLKSMTADKLVGLYRNHDLSVTEVIQSVFDEIERSDKNIRAFLS |
| Ga0066689_107570471 | 3300005447 | Soil | MNLKNITADKLVALYKNRDLTVTEVITNVYDEIERTDQDVRSF |
| Ga0070685_100519634 | 3300005466 | Switchgrass Rhizosphere | MNLKNMTADRLVGLYRNHDLSVTEVIRSVFDEIERNDKNIHAFLTLCKDR |
| Ga0070686_1012662243 | 3300005544 | Switchgrass Rhizosphere | MNLKNITADRLVSLYANRDLSVTEVITSVFDEIDRSDGNIHAFITLCRERALEEARRT |
| Ga0066698_104800493 | 3300005558 | Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIECTDKDVRAFLSICRERALEEAR |
| Ga0066705_105480923 | 3300005569 | Soil | MNLKDITAEKLVGLYRNRDLTVTEVITSTYGDIERIDKDVRAFITLCPLRAFEEARRMDERIASGE |
| Ga0066708_106282623 | 3300005576 | Soil | MNLRNITADKLVALYQNRDLTASEVITSVYDEIERRDKEVHAFLSNCRERALEEA |
| Ga0070702_1013104793 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLKSMTADKLVGLYRNHDLSVTEVIQSVFDEIERSDKNIRAFLSLC |
| Ga0066905_1011151771 | 3300005713 | Tropical Forest Soil | MNLKNITADKLVALYRNRDLTITEVIKNVYEQIERVDKD |
| Ga0068861_1025244881 | 3300005719 | Switchgrass Rhizosphere | MNLKNITADKLVALYKNHDLRVTEVIKSVYEEIDKVDKDVRAFL |
| Ga0074470_104290964 | 3300005836 | Sediment (Intertidal) | MNLRTLTADKLVSFYQHGDLSVMEVITSVFDEIERTDKDVRAYIT |
| Ga0074470_111981141 | 3300005836 | Sediment (Intertidal) | MNLKNITADRLVSLYANHDLSVTEVITSVFDEIDRSDGNIHAFITLCREPAGRR* |
| Ga0068870_109776693 | 3300005840 | Miscanthus Rhizosphere | MNLKNITADKLVALYKNHDLRVTEVIKSVYEEIDKVDK |
| Ga0068860_1005816264 | 3300005843 | Switchgrass Rhizosphere | MNLKSITADKLVSLYAHRDLTVTEVISSVFEEIDRSDKSIHAFITLCR |
| Ga0075417_104207671 | 3300006049 | Populus Rhizosphere | MNLKNITADKLVALYKNRDLTVTEVIKSAYEEIERTDGGVRAFLSLCPERALDEARRLDA |
| Ga0066658_101894141 | 3300006794 | Soil | MNLRNITADKLVALYQNRDLTASEVITSVYDEIERRDKEVHAFLSNC |
| Ga0066659_118090311 | 3300006797 | Soil | MNLKNITADKLVALYKNRDLTVTEVITNVYDEIERTDQDVRSFISLSRDRALEEARR |
| Ga0075428_1013924921 | 3300006844 | Populus Rhizosphere | MNLKNITADKLVALYKNRDLTATEVIKGVYEQIEHVDKDVHAFLSLNP |
| Ga0075421_1002491461 | 3300006845 | Populus Rhizosphere | MNLKNITADKLVALYRNRDLTITEVIKNVYNQIEGVDKDVRAFLSICPERALDEARRLDGQI |
| Ga0075430_1002144714 | 3300006846 | Populus Rhizosphere | MNLKNITADKLVALYRNRDLTITEVIKNVYDQIERVDKDVR |
| Ga0075433_108332491 | 3300006852 | Populus Rhizosphere | MNLKNITADRLVALYKNRDLTVTEVIKSVYQEIERSDSQVRAFLWLCPERALDEARRLDARISA |
| Ga0075434_1010214511 | 3300006871 | Populus Rhizosphere | MNLKNITADKLAALYRNKDLSVTEVIKSTYEEVARVDKSIRAFISLS |
| Ga0066710_1021933621 | 3300009012 | Grasslands Soil | MNLKDITADKLVSLYKNRDLTVTEVITGVYKEIERTDKDVRAF |
| Ga0066710_1024470751 | 3300009012 | Grasslands Soil | MNLKNITADKLIALYKNKDLSVSEVISGTYEEIVRTDKDI |
| Ga0111539_121534641 | 3300009094 | Populus Rhizosphere | MNLKNLTADKLALLYRNRDVTVTEVVRNLFEEIDRTDP |
| Ga0105245_113301153 | 3300009098 | Miscanthus Rhizosphere | MNLKNITADKLVSLYANRDLSVTEVINSVFDEIDRSDGNIHAFITLCRERALEE |
| Ga0066709_1044462682 | 3300009137 | Grasslands Soil | MNLKDITADKLVALYKNRDLTATEVITNVYDEIERTDKDVRAFLSTCRDRALEEARRMDTRIT |
| Ga0114129_109798994 | 3300009147 | Populus Rhizosphere | MNLKNLTADKLALLYRNRDVTVTEVVRNLFEEIDRTDPSVRAFITLSRER |
| Ga0075423_104692431 | 3300009162 | Populus Rhizosphere | MNLKNLTADKLVALYKNRDLTVTEVIKGVYHEIERVDKDVRAFLWL |
| Ga0105249_112392511 | 3300009553 | Switchgrass Rhizosphere | MNLRDITADKLVALYQNRDASVTEVITSVFEEIERTDRSVRAFLTVCK |
| Ga0126373_105173094 | 3300010048 | Tropical Forest Soil | MNLKNITADKLVALYRNRDLSVTEVIKSVYEEIDRVDGSVKAFLSVSPDRALEDAR |
| Ga0126373_115657203 | 3300010048 | Tropical Forest Soil | MNLKNITADKLVALYRNRDLTITEVIKNVYEEIEQVDKDVRAFLSIC |
| Ga0127496_10528383 | 3300010086 | Grasslands Soil | MNLQNITADKLVGLYKNRDLTASEVITSLYEDIERTDKDVRAFLSIYRERALEEARR |
| Ga0134086_101313764 | 3300010323 | Grasslands Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIERTDKDVHAFLSI |
| Ga0134111_105489271 | 3300010329 | Grasslands Soil | MNLKNITADKLVGLYLNRDLSVTEVVTSTYQEIERIDKDVRAFITQCPLRAFEEARRMDE |
| Ga0126370_105112671 | 3300010358 | Tropical Forest Soil | MNLKNITADKLVVLYRNRDLSVTEVIKSVYEEIDRVDGSVKAFLSVSP |
| Ga0126372_107771574 | 3300010360 | Tropical Forest Soil | MNLKNITADKLVALYQNRDLTVTEVIKSVYEEIDRVDGRVKAFLSVSPDRALDEARRL |
| Ga0126372_120693541 | 3300010360 | Tropical Forest Soil | MNLKNITADKLVALYRNRDLTITEVIKNVYEEIEQVDKDVRAF |
| Ga0126379_109266381 | 3300010366 | Tropical Forest Soil | MNLKNITADKLVALYRNRDLTITEVIKNVFEQIEQVDKDV |
| Ga0134124_110115384 | 3300010397 | Terrestrial Soil | MNLKTITADKLVALYKNRDLTVTEVIMGVYEQIANVDQ |
| Ga0134127_134554623 | 3300010399 | Terrestrial Soil | MNLKNMTADRLVGLYRNHDLSVTEVIRSVFDEIERNDKNIHAFLTLCKERA |
| Ga0134122_115886201 | 3300010400 | Terrestrial Soil | MNLKNITADKLVSLYAKRDLSVTEVVNGVFEEIDRSDKNIRAFITLCRESALEDARQ |
| Ga0134121_105937791 | 3300010401 | Terrestrial Soil | MNLKNITADRLLPLYANRDVSVTEVITSVFEEIDKSDGNLRAFVTLCRDRALEE |
| Ga0137433_13153631 | 3300011440 | Soil | MNLKNITADKLVALYKNGDLSVTEVITSVFDEIDRTDNDVHAYIT |
| Ga0137421_12413873 | 3300012039 | Soil | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIDR |
| Ga0137363_109985331 | 3300012202 | Vadose Zone Soil | MNLKDITADKLVSLYKNRDMTVSEVITSVYEEIERT |
| Ga0137379_104558321 | 3300012209 | Vadose Zone Soil | MNLKDITADKLVALYKNRDLSVTEVIKNVYEEIDRTDKNLRAFITICPERALDEA |
| Ga0137377_115679491 | 3300012211 | Vadose Zone Soil | MNLKDITADKLVSLYKNRDLTVTEVITGVYEEIERTDKD |
| Ga0137384_107179113 | 3300012357 | Vadose Zone Soil | MNLKDITADKLVALYKNRDLSVTEVIKSVYEEIDRVDKQVRAFITI |
| Ga0134031_11790883 | 3300012388 | Grasslands Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIEC |
| Ga0150984_1139350683 | 3300012469 | Avena Fatua Rhizosphere | MKLKDFTAEKLVALYKNRDLSVTEVITNVFQEIERTDKD |
| Ga0150984_1157003051 | 3300012469 | Avena Fatua Rhizosphere | MNLKNITAEKLVALYRNKDLSVSEVISGTYEEIVHTEKTLHAFISLC |
| Ga0137410_119605863 | 3300012944 | Vadose Zone Soil | MNLKNITADRLVSLYANRDLSVTEVITSVFDEIDRND |
| Ga0126375_101421941 | 3300012948 | Tropical Forest Soil | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIERSDSQVRAF |
| Ga0126375_106779501 | 3300012948 | Tropical Forest Soil | MNLKNLTADKLVALYKNRDLTVTEVIKGVYDEIERVDKDVRAFLWL |
| Ga0126375_114116331 | 3300012948 | Tropical Forest Soil | MNLKNISADKLVALYKNRDLTVREVIEGVYDEIDRVDKHIRAFL |
| Ga0126375_120760901 | 3300012948 | Tropical Forest Soil | MNLKDITAERLVNLYRNGDLSVTEVVRSLYDEIDRIDRDVRAFITLSRDRAL |
| Ga0126369_135738313 | 3300012971 | Tropical Forest Soil | MKLKQITADKLVALYKNRDLTVTEVIQGVYEEIERVDRNIKAFLSLCPDRALDE |
| Ga0075342_11786681 | 3300014320 | Natural And Restored Wetlands | MNLNNITADKLVALYKNKDLSVSEVIRSTYEEIARIDKGIRAFISLCPERALEEARRM |
| Ga0132257_1004724714 | 3300015373 | Arabidopsis Rhizosphere | MNLRNITADKLVALYKNREVSVTEVIKSVYEEIEKVDKDVRALLSICPDRALDDGRRL |
| Ga0182037_113219003 | 3300016404 | Soil | MNLKNITADKLVALYRNRDLTVTEVIKGVYDSIERVDKDVRAFLS |
| Ga0134112_104011153 | 3300017656 | Grasslands Soil | MNLKNITADKLASLYKNGDLTVTEVITSVFDEIDRTDKDVRAFITLCQD |
| Ga0134074_14073392 | 3300017657 | Grasslands Soil | MNLKNITADKLVGLYLNRDLSVTEVVTSTYQEIERIDKDVRAFITQCPLRAFEEARRMDEQIATGE |
| Ga0163161_118380041 | 3300017792 | Switchgrass Rhizosphere | MNLKNITADKLVALYANRDLTVSEVITSVFEEIDRTDKSVRAFITLCRDRA |
| Ga0190266_110584343 | 3300017965 | Soil | MNLKNLTADRLVQLYANRDLTVTEVITSVFDEIDRSDG |
| Ga0184640_101729864 | 3300018074 | Groundwater Sediment | MNLRNITADKLVALYKNKDLSVSEVIRATYEEIERTDKEIHSYISLCPERALEEAR |
| Ga0184627_104228061 | 3300018079 | Groundwater Sediment | MNLRNITADKLVALYKNKDLSVSEVIRATYEEIERTDKEIHSYISLCPERA |
| Ga0187893_102726521 | 3300019487 | Microbial Mat On Rocks | MNLKTITAEKLVSLYKNHDLTVTEVVTGVFDDIERLDKDVRAFITLC |
| Ga0222622_102946774 | 3300022756 | Groundwater Sediment | MNLKNITADRLVSLYANRDLTVTEVITSVFDEIDKS |
| Ga0209324_108321551 | 3300025174 | Soil | MNLKNITADKLVALYKNRDLTVTEVIRSVYEEIERSDRDIRAFITICPDRA |
| Ga0207711_113806733 | 3300025941 | Switchgrass Rhizosphere | MNLKNITADRLVSLYANRDLSVTEVITSVFDEIDRSDGNIRAFITLCRERAL |
| Ga0207651_100435757 | 3300025960 | Switchgrass Rhizosphere | MNLKNITADKLVSLYANRDLSVTEVINSVFDEIDRSDGNIHAF |
| Ga0207712_108091253 | 3300025961 | Switchgrass Rhizosphere | MNLRDITADKLVALYQNRDASVTEVITSVFEEIERTDRSVRAFLTVC |
| Ga0207668_110789541 | 3300025972 | Switchgrass Rhizosphere | MNLKNMTADKLVGLYRNHDLSVTEVVRSVFDEIDRNDQSIHA |
| Ga0207683_111552653 | 3300026121 | Miscanthus Rhizosphere | MNLRDITADKLVALYQNRDASVTEVITSVFEEIER |
| Ga0207683_116687203 | 3300026121 | Miscanthus Rhizosphere | MNLKNITADRLVSAYANRDLSVTEVITSVFDEIDRSDGNIHAFITLCRERALEEAR |
| Ga0209472_10430914 | 3300026323 | Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIERTDKDV |
| Ga0209808_13019463 | 3300026523 | Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIERTDKDVHAFLSICRER |
| Ga0209056_101895284 | 3300026538 | Soil | MNLQNITADKLVGLYKNRDLTATEVITSLYEDIERTDKDVRAFLSIYRERALEEA |
| Ga0209465_102579293 | 3300027874 | Tropical Forest Soil | MNLRNITADKLVALYKNREISVTEVIKSVYEEIEKV |
| Ga0307468_1016642583 | 3300031740 | Hardwood Forest Soil | MNLKGITAERLVTLYKNRDLTVTEVIKGVYDEIDRVDKDVRAFLSLSPERALDDARRMDGKIAAG |
| Ga0310907_106507461 | 3300031847 | Soil | MNLRDITADKLVALYQNRDASVTEVITSVFEEIERTDRSVRAFLTV |
| Ga0306925_110464443 | 3300031890 | Soil | MNLKNITADKLVALYRNRDLTVTEVIKGVYDSIERVDK |
| Ga0310900_108302231 | 3300031908 | Soil | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIDRVDKDVRAFISL |
| Ga0306921_123032103 | 3300031912 | Soil | MNLKNITADKLVALYRNRDLSVTEVIKSVYEQAERVEPGI |
| Ga0310910_111552733 | 3300031946 | Soil | MNLKNITADKLVALYRNRDLTVTEVIKGVYDSIERVDKDVRAFLSICPDRALDEARRLDA |
| Ga0306926_106857001 | 3300031954 | Soil | MNLKNITADKLVALYKNRDLTVTEVITNVYEEIDRTDPDVHAFMSLCRDRA |
| Ga0307471_1038978701 | 3300032180 | Hardwood Forest Soil | MNLKNITADKLVALYKNRDLTVTEVITNVYDEIEHTDR |
| Ga0307472_1012795483 | 3300032205 | Hardwood Forest Soil | VNLQNITADKLVGLYKNRDLTASEVITSLYEDIERTGKDVRA |
| Ga0306920_1009248651 | 3300032261 | Soil | MNLKNITADKLVALYRNRDLTVTEVIKGVYDSIERVDKDVRAFLSICPDRALDEARRLDAQIA |
| Ga0310914_113585363 | 3300033289 | Soil | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIDRVDGKVKAFLALC |
| Ga0314793_077937_512_655 | 3300034668 | Soil | MNLKNITADKLVALYKNRDLTVTEVIKSVYEEIDRVDKDVRAFISLCP |
| ⦗Top⦘ |