| Basic Information | |
|---|---|
| Family ID | F095237 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKT |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 44.76 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (100.000 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (37.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (76.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.88% Coil/Unstructured: 65.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 13.33 |
| PF00355 | Rieske | 6.67 |
| PF01154 | HMG_CoA_synt_N | 1.90 |
| PF01656 | CbiA | 0.95 |
| PF01253 | SUI1 | 0.95 |
| PF03952 | Enolase_N | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 13.33 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 13.33 |
| COG3425 | 3-hydroxy-3-methylglutaryl CoA synthase | Lipid transport and metabolism [I] | 1.90 |
| COG0023 | Translation initiation factor 1 (eIF-1/SUI1) | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1085558 | All Organisms → cellular organisms → Archaea | 524 | Open in IMG/M |
| 3300002560|JGI25383J37093_10090504 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 910 | Open in IMG/M |
| 3300002561|JGI25384J37096_10054181 | All Organisms → cellular organisms → Archaea | 1515 | Open in IMG/M |
| 3300002908|JGI25382J43887_10229256 | All Organisms → cellular organisms → Archaea | 870 | Open in IMG/M |
| 3300002912|JGI25386J43895_10115135 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 668 | Open in IMG/M |
| 3300005167|Ga0066672_10176996 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1350 | Open in IMG/M |
| 3300005174|Ga0066680_10181959 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1324 | Open in IMG/M |
| 3300005176|Ga0066679_10110213 | All Organisms → cellular organisms → Archaea | 1684 | Open in IMG/M |
| 3300005176|Ga0066679_10241575 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1161 | Open in IMG/M |
| 3300005176|Ga0066679_10691269 | All Organisms → cellular organisms → Archaea | 662 | Open in IMG/M |
| 3300005187|Ga0066675_10341075 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1094 | Open in IMG/M |
| 3300005187|Ga0066675_10938657 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 652 | Open in IMG/M |
| 3300005445|Ga0070708_101398266 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 653 | Open in IMG/M |
| 3300005446|Ga0066686_10090034 | All Organisms → cellular organisms → Archaea | 1959 | Open in IMG/M |
| 3300005447|Ga0066689_10993718 | All Organisms → cellular organisms → Archaea | 517 | Open in IMG/M |
| 3300005451|Ga0066681_10011825 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 4268 | Open in IMG/M |
| 3300005468|Ga0070707_100666167 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1003 | Open in IMG/M |
| 3300005540|Ga0066697_10265843 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1014 | Open in IMG/M |
| 3300005552|Ga0066701_10096460 | All Organisms → cellular organisms → Archaea | 1720 | Open in IMG/M |
| 3300005556|Ga0066707_10409527 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 882 | Open in IMG/M |
| 3300005557|Ga0066704_10142617 | All Organisms → cellular organisms → Archaea | 1602 | Open in IMG/M |
| 3300005568|Ga0066703_10191353 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1239 | Open in IMG/M |
| 3300006031|Ga0066651_10002141 | All Organisms → cellular organisms → Archaea | 7016 | Open in IMG/M |
| 3300006794|Ga0066658_10511287 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 654 | Open in IMG/M |
| 3300006796|Ga0066665_10611558 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 874 | Open in IMG/M |
| 3300006797|Ga0066659_10143792 | All Organisms → cellular organisms → Archaea | 1687 | Open in IMG/M |
| 3300006804|Ga0079221_11617242 | All Organisms → cellular organisms → Archaea | 525 | Open in IMG/M |
| 3300009012|Ga0066710_102314777 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 781 | Open in IMG/M |
| 3300009012|Ga0066710_102503355 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 746 | Open in IMG/M |
| 3300009089|Ga0099828_10507107 | All Organisms → cellular organisms → Archaea | 1088 | Open in IMG/M |
| 3300009090|Ga0099827_10179100 | All Organisms → cellular organisms → Archaea | 1752 | Open in IMG/M |
| 3300009090|Ga0099827_11157687 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 672 | Open in IMG/M |
| 3300009137|Ga0066709_101402639 | All Organisms → cellular organisms → Archaea | 1016 | Open in IMG/M |
| 3300010075|Ga0127434_162705 | All Organisms → cellular organisms → Archaea | 1408 | Open in IMG/M |
| 3300010083|Ga0127478_1004481 | All Organisms → cellular organisms → Archaea | 753 | Open in IMG/M |
| 3300010091|Ga0127485_1004504 | All Organisms → cellular organisms → Archaea | 608 | Open in IMG/M |
| 3300010101|Ga0127481_1098636 | All Organisms → cellular organisms → Archaea | 827 | Open in IMG/M |
| 3300010103|Ga0127500_1016519 | All Organisms → cellular organisms → Archaea | 528 | Open in IMG/M |
| 3300010104|Ga0127446_1065783 | All Organisms → cellular organisms → Archaea | 724 | Open in IMG/M |
| 3300010107|Ga0127494_1139563 | All Organisms → cellular organisms → Archaea | 582 | Open in IMG/M |
| 3300010109|Ga0127497_1098023 | All Organisms → cellular organisms → Archaea | 648 | Open in IMG/M |
| 3300010114|Ga0127460_1112270 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 669 | Open in IMG/M |
| 3300010117|Ga0127449_1110448 | All Organisms → cellular organisms → Archaea | 546 | Open in IMG/M |
| 3300010120|Ga0127451_1151860 | All Organisms → cellular organisms → Archaea | 515 | Open in IMG/M |
| 3300010122|Ga0127488_1145999 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300010125|Ga0127443_1037666 | All Organisms → cellular organisms → Archaea | 622 | Open in IMG/M |
| 3300010133|Ga0127459_1039348 | All Organisms → cellular organisms → Archaea | 859 | Open in IMG/M |
| 3300010134|Ga0127484_1156681 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 885 | Open in IMG/M |
| 3300010136|Ga0127447_1156691 | All Organisms → cellular organisms → Archaea | 1391 | Open in IMG/M |
| 3300010140|Ga0127456_1225152 | All Organisms → cellular organisms → Archaea | 545 | Open in IMG/M |
| 3300010142|Ga0127483_1074453 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 784 | Open in IMG/M |
| 3300010304|Ga0134088_10229174 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 892 | Open in IMG/M |
| 3300010304|Ga0134088_10247277 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 858 | Open in IMG/M |
| 3300010326|Ga0134065_10143094 | All Organisms → cellular organisms → Archaea | 829 | Open in IMG/M |
| 3300010336|Ga0134071_10296499 | All Organisms → cellular organisms → Archaea | 811 | Open in IMG/M |
| 3300010366|Ga0126379_10102947 | All Organisms → cellular organisms → Archaea | 2546 | Open in IMG/M |
| 3300012189|Ga0137388_11551171 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 599 | Open in IMG/M |
| 3300012199|Ga0137383_11149709 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 560 | Open in IMG/M |
| 3300012199|Ga0137383_11197324 | All Organisms → cellular organisms → Archaea | 546 | Open in IMG/M |
| 3300012206|Ga0137380_10139396 | All Organisms → cellular organisms → Archaea | 2212 | Open in IMG/M |
| 3300012206|Ga0137380_10485979 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1089 | Open in IMG/M |
| 3300012208|Ga0137376_10584622 | All Organisms → cellular organisms → Archaea | 967 | Open in IMG/M |
| 3300012209|Ga0137379_11361184 | All Organisms → cellular organisms → Archaea | 614 | Open in IMG/M |
| 3300012224|Ga0134028_1271571 | All Organisms → cellular organisms → Archaea | 881 | Open in IMG/M |
| 3300012349|Ga0137387_10150581 | All Organisms → cellular organisms → Archaea | 1656 | Open in IMG/M |
| 3300012349|Ga0137387_10171466 | All Organisms → cellular organisms → Archaea | 1552 | Open in IMG/M |
| 3300012351|Ga0137386_10042163 | All Organisms → cellular organisms → Archaea | 3134 | Open in IMG/M |
| 3300012351|Ga0137386_10701748 | All Organisms → cellular organisms → Archaea | 727 | Open in IMG/M |
| 3300012351|Ga0137386_11215163 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 527 | Open in IMG/M |
| 3300012357|Ga0137384_10841802 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 741 | Open in IMG/M |
| 3300012361|Ga0137360_11220239 | All Organisms → cellular organisms → Archaea | 650 | Open in IMG/M |
| 3300012362|Ga0137361_10968055 | All Organisms → cellular organisms → Archaea | 770 | Open in IMG/M |
| 3300012373|Ga0134042_1110721 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 754 | Open in IMG/M |
| 3300012379|Ga0134058_1172954 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 947 | Open in IMG/M |
| 3300012392|Ga0134043_1080876 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 631 | Open in IMG/M |
| 3300012397|Ga0134056_1353625 | All Organisms → cellular organisms → Archaea | 1370 | Open in IMG/M |
| 3300012397|Ga0134056_1355239 | All Organisms → cellular organisms → Archaea | 700 | Open in IMG/M |
| 3300012398|Ga0134051_1223458 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1137 | Open in IMG/M |
| 3300012401|Ga0134055_1050647 | All Organisms → cellular organisms → Archaea | 731 | Open in IMG/M |
| 3300012401|Ga0134055_1321475 | All Organisms → cellular organisms → Archaea | 1322 | Open in IMG/M |
| 3300012409|Ga0134045_1066269 | All Organisms → cellular organisms → Archaea | 1297 | Open in IMG/M |
| 3300012410|Ga0134060_1168145 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
| 3300012532|Ga0137373_10335674 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1191 | Open in IMG/M |
| 3300012972|Ga0134077_10219161 | All Organisms → cellular organisms → Archaea | 780 | Open in IMG/M |
| 3300012972|Ga0134077_10541446 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 520 | Open in IMG/M |
| 3300012976|Ga0134076_10302924 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 693 | Open in IMG/M |
| 3300014157|Ga0134078_10376737 | All Organisms → cellular organisms → Archaea | 631 | Open in IMG/M |
| 3300015358|Ga0134089_10478528 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 543 | Open in IMG/M |
| 3300015359|Ga0134085_10451305 | All Organisms → cellular organisms → Archaea | 583 | Open in IMG/M |
| 3300018433|Ga0066667_10515591 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 987 | Open in IMG/M |
| 3300018468|Ga0066662_10092682 | All Organisms → cellular organisms → Archaea | 2110 | Open in IMG/M |
| 3300026298|Ga0209236_1240512 | All Organisms → cellular organisms → Archaea | 606 | Open in IMG/M |
| 3300026306|Ga0209468_1169646 | All Organisms → cellular organisms → Archaea | 554 | Open in IMG/M |
| 3300026317|Ga0209154_1161560 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 919 | Open in IMG/M |
| 3300026334|Ga0209377_1209909 | All Organisms → cellular organisms → Archaea | 646 | Open in IMG/M |
| 3300026342|Ga0209057_1035214 | All Organisms → cellular organisms → Archaea | 2565 | Open in IMG/M |
| 3300026523|Ga0209808_1284011 | All Organisms → cellular organisms → Archaea | 531 | Open in IMG/M |
| 3300026536|Ga0209058_1275931 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 580 | Open in IMG/M |
| 3300026538|Ga0209056_10160594 | All Organisms → cellular organisms → Archaea | 1704 | Open in IMG/M |
| 3300026548|Ga0209161_10491133 | All Organisms → cellular organisms → Archaea | 542 | Open in IMG/M |
| 3300026551|Ga0209648_10654204 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 575 | Open in IMG/M |
| 3300027875|Ga0209283_10740633 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 610 | Open in IMG/M |
| 3300027882|Ga0209590_10138094 | All Organisms → cellular organisms → Archaea | 1499 | Open in IMG/M |
| 3300027882|Ga0209590_10709527 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 643 | Open in IMG/M |
| 3300031720|Ga0307469_10647496 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 951 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 37.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10855582 | 3300002557 | Grasslands Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPK |
| JGI25383J37093_100905041 | 3300002560 | Grasslands Soil | MSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEV |
| JGI25384J37096_100541811 | 3300002561 | Grasslands Soil | MSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHKLKE |
| JGI25382J43887_102292562 | 3300002908 | Grasslands Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIV |
| JGI25386J43895_101151352 | 3300002912 | Grasslands Soil | VTGLSEGFDFDSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLAEVAHKLKE |
| Ga0066672_101769961 | 3300005167 | Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKT |
| Ga0066680_101819593 | 3300005174 | Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPV |
| Ga0066679_101102131 | 3300005176 | Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTG |
| Ga0066679_102415752 | 3300005176 | Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTILQGLPKTGRSLDEVAHRL |
| Ga0066679_106912692 | 3300005176 | Soil | LTESLSEDFDFDAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKT |
| Ga0066675_103410751 | 3300005187 | Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTG |
| Ga0066675_109386571 | 3300005187 | Soil | MTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLAEV |
| Ga0070708_1013982661 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQG |
| Ga0066686_100900344 | 3300005446 | Soil | MTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQ |
| Ga0066689_109937181 | 3300005447 | Soil | VQHLTENLSEDFDFNAALKELDKSEPHLVVRVEFRRWGKPVTIVQGLPK |
| Ga0066681_100118251 | 3300005451 | Soil | VQHLTENLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLP |
| Ga0070707_1006661672 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LIESLSDDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGL |
| Ga0066697_102658431 | 3300005540 | Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVT |
| Ga0066701_100964601 | 3300005552 | Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRS |
| Ga0066707_104095272 | 3300005556 | Soil | MTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTG |
| Ga0066704_101426171 | 3300005557 | Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWG |
| Ga0066703_101913533 | 3300005568 | Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPV |
| Ga0066651_100021411 | 3300006031 | Soil | LTENLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGL |
| Ga0066658_105112872 | 3300006794 | Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLP |
| Ga0066665_106115582 | 3300006796 | Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVT |
| Ga0066659_101437921 | 3300006797 | Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIV |
| Ga0079221_116172422 | 3300006804 | Agricultural Soil | MSLTENLSGDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIV |
| Ga0066710_1023147771 | 3300009012 | Grasslands Soil | VTGLSEGFDFDSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLA |
| Ga0066710_1025033551 | 3300009012 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLA |
| Ga0099828_105071073 | 3300009089 | Vadose Zone Soil | MSEGFNLDTALKELDKSETHLVVRMELRKWGKPMTVIQGLPKTGKSIDEIAHK |
| Ga0099827_101791001 | 3300009090 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVKVEFRRWGKPVTVVQGLPKTGRS |
| Ga0099827_111576871 | 3300009090 | Vadose Zone Soil | VTELSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVT |
| Ga0066709_1014026392 | 3300009137 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGL |
| Ga0127434_1627053 | 3300010075 | Grasslands Soil | MESLSGDFDFDAALKELDKSETHLVVRVELRRWGKPMTIIQGLPETGRSLDEVAHR |
| Ga0127478_10044812 | 3300010083 | Grasslands Soil | MESLSEDFDFDAALKELDKSETHLVVRVELRRWGK |
| Ga0127485_10045041 | 3300010091 | Grasslands Soil | MESLSGDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQGL |
| Ga0127481_10986362 | 3300010101 | Grasslands Soil | MESLSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMT |
| Ga0127500_10165192 | 3300010103 | Grasslands Soil | MESLSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPETGRSLDE |
| Ga0127446_10657832 | 3300010104 | Grasslands Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLD |
| Ga0127494_11395631 | 3300010107 | Grasslands Soil | MESLSGDFDFDAALKELDKSETHLVVRVELRRWGKPMT |
| Ga0127497_10980232 | 3300010109 | Grasslands Soil | MESLSEDFDFDAALKELDKSETHLVVRVELRRWGKPMTIIQGLP |
| Ga0127460_11122701 | 3300010114 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVARKLKER |
| Ga0127449_11104482 | 3300010117 | Grasslands Soil | MAPPVKHLTESLSEDFDFNAALKELDKSETHLVVRVEFR |
| Ga0127451_11518602 | 3300010120 | Grasslands Soil | MESLSGDFDFDAALKELDKSETHLVVRVELRRWGKPMTIIQGLPE |
| Ga0127488_11459991 | 3300010122 | Grasslands Soil | MESLSGDFDFDAALKELDKSETHLVVRVELRRWGKPMTIIQ |
| Ga0127443_10376661 | 3300010125 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRS |
| Ga0127459_10393482 | 3300010133 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVELRRWGKPMTIIQGLPKTGRSLDEI |
| Ga0127484_11566812 | 3300010134 | Grasslands Soil | VEHLIENLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLDEVAHR |
| Ga0127447_11566913 | 3300010136 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPK |
| Ga0127456_12251522 | 3300010140 | Grasslands Soil | LSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTII |
| Ga0127483_10744531 | 3300010142 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPK |
| Ga0134088_102291741 | 3300010304 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLAEVAHKLKERLAT |
| Ga0134088_102472771 | 3300010304 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQG |
| Ga0134065_101430942 | 3300010326 | Grasslands Soil | LTENLSEDFDFNAALKELDKSETHLIVRVEFRRWGKPVTIVQGL |
| Ga0134071_102964991 | 3300010336 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVELRRWGKPMTIIQGLPK |
| Ga0126379_101029471 | 3300010366 | Tropical Forest Soil | LSGDFDFNAALKELDKTETHLVVRVEFRRWGKPMTIIQG |
| Ga0137388_115511711 | 3300012189 | Vadose Zone Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQ |
| Ga0137383_111497092 | 3300012199 | Vadose Zone Soil | VTVLSEGFDFNSALKELDKSETHLTVRVEFRRWGK |
| Ga0137383_111973242 | 3300012199 | Vadose Zone Soil | LSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPETGRSL |
| Ga0137380_101393961 | 3300012206 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHKLKE |
| Ga0137380_104859791 | 3300012206 | Vadose Zone Soil | VSRVAGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHK |
| Ga0137376_105846223 | 3300012208 | Vadose Zone Soil | LSEDFDFNAALKELDKSETHLVVRVEFLRWGKPVTIVQGLPKTGRSLDEVAHR |
| Ga0137379_113611841 | 3300012209 | Vadose Zone Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLDE |
| Ga0134028_12715711 | 3300012224 | Grasslands Soil | MESLSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQ |
| Ga0137387_101505811 | 3300012349 | Vadose Zone Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQG |
| Ga0137387_101714663 | 3300012349 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVV |
| Ga0137386_100421631 | 3300012351 | Vadose Zone Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLDEV |
| Ga0137386_107017481 | 3300012351 | Vadose Zone Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLDEVAH |
| Ga0137386_112151631 | 3300012351 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVT |
| Ga0137384_108418022 | 3300012357 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPK |
| Ga0137360_112202392 | 3300012361 | Vadose Zone Soil | LIESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGL |
| Ga0137361_109680552 | 3300012362 | Vadose Zone Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPKTGRSLD |
| Ga0134042_11107212 | 3300012373 | Grasslands Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPK |
| Ga0134058_11729541 | 3300012379 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKP |
| Ga0134043_10808761 | 3300012392 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHKLKERLAT |
| Ga0134056_13536251 | 3300012397 | Grasslands Soil | LSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQGL |
| Ga0134056_13552392 | 3300012397 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPKTGRSLDEIA |
| Ga0134051_12234581 | 3300012398 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGL |
| Ga0134055_10506472 | 3300012401 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPKT |
| Ga0134055_13214751 | 3300012401 | Grasslands Soil | LIESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPKTGR |
| Ga0134045_10662691 | 3300012409 | Grasslands Soil | LSEGFDLNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTG |
| Ga0134060_11681452 | 3300012410 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQ |
| Ga0137373_103356741 | 3300012532 | Vadose Zone Soil | VSRVAGLSEGFDFNSALKELDKSETHLTVRVEFRR |
| Ga0134077_102191612 | 3300012972 | Grasslands Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRR |
| Ga0134077_105414462 | 3300012972 | Grasslands Soil | VSEGFDFNGALKDVDKSEAHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHKLKERLA |
| Ga0134076_103029241 | 3300012976 | Grasslands Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGNP |
| Ga0134078_103767371 | 3300014157 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTI |
| Ga0134089_104785281 | 3300015358 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLDEVAHR |
| Ga0134085_104513052 | 3300015359 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKT |
| Ga0066667_105155912 | 3300018433 | Grasslands Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGR |
| Ga0066662_100926821 | 3300018468 | Grasslands Soil | MSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKT |
| Ga0209236_12405121 | 3300026298 | Grasslands Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPKTG |
| Ga0209468_11696462 | 3300026306 | Soil | LTENLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSL |
| Ga0209154_11615601 | 3300026317 | Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTILQGLPKTGRSLDEVAHRLKA |
| Ga0209377_12099092 | 3300026334 | Soil | LSEDFDFDAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPK |
| Ga0209057_10352147 | 3300026342 | Soil | LTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLD |
| Ga0209808_12840111 | 3300026523 | Soil | LSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGLPKTGRSLD |
| Ga0209058_12759312 | 3300026536 | Soil | LSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVLQGLPKTGRSLA |
| Ga0209056_101605944 | 3300026538 | Soil | VQHLTESLSEDFDFNAALKELDKSETHLVVRVEFRRWGKPVTIVQGL |
| Ga0209161_104911332 | 3300026548 | Soil | MESLSEDFDFDAALKELDKSETHLVVRVEFRRWGKPMTIIQGLPETGRSLD |
| Ga0209648_106542041 | 3300026551 | Grasslands Soil | VTVLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTG |
| Ga0209283_107406332 | 3300027875 | Vadose Zone Soil | LSEGFDFNSALKELDKSETHLTIRVEFRRWGKPVTVVQGLPKTGRSL |
| Ga0209590_101380943 | 3300027882 | Vadose Zone Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTGRSLAEVAHKL |
| Ga0209590_107095271 | 3300027882 | Vadose Zone Soil | VTELSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTV |
| Ga0307469_106474962 | 3300031720 | Hardwood Forest Soil | VTGLSEGFDFNSALKELDKSETHLTVRVEFRRWGKPVTVVQGLPKTG |
| ⦗Top⦘ |