| Basic Information | |
|---|---|
| Family ID | F095231 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | QFPSRSVTSRLDAPVLNALVTVTNTRGETLFRARESFYWHAPD |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.85 % |
| % of genes near scaffold ends (potentially truncated) | 95.24 % |
| % of genes from short scaffolds (< 2000 bps) | 79.05 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.476 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.76% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 5.71 |
| PF07883 | Cupin_2 | 4.76 |
| PF09832 | DUF2059 | 4.76 |
| PF12867 | DinB_2 | 2.86 |
| PF12695 | Abhydrolase_5 | 1.90 |
| PF03544 | TonB_C | 1.90 |
| PF12146 | Hydrolase_4 | 1.90 |
| PF01872 | RibD_C | 1.90 |
| PF12120 | Arr-ms | 1.90 |
| PF01791 | DeoC | 1.90 |
| PF04794 | YdjC | 0.95 |
| PF00067 | p450 | 0.95 |
| PF00144 | Beta-lactamase | 0.95 |
| PF12098 | DUF3574 | 0.95 |
| PF03740 | PdxJ | 0.95 |
| PF13683 | rve_3 | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF13442 | Cytochrome_CBB3 | 0.95 |
| PF01527 | HTH_Tnp_1 | 0.95 |
| PF13453 | zf-TFIIB | 0.95 |
| PF13540 | RCC1_2 | 0.95 |
| PF14559 | TPR_19 | 0.95 |
| PF01040 | UbiA | 0.95 |
| PF12796 | Ank_2 | 0.95 |
| PF01546 | Peptidase_M20 | 0.95 |
| PF00903 | Glyoxalase | 0.95 |
| PF07859 | Abhydrolase_3 | 0.95 |
| PF11918 | Peptidase_S41_N | 0.95 |
| PF00034 | Cytochrom_C | 0.95 |
| PF04055 | Radical_SAM | 0.95 |
| PF13474 | SnoaL_3 | 0.95 |
| PF10706 | Aminoglyc_resit | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 5.71 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 5.71 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 5.71 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.90 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.90 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.95 |
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 0.95 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.95 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.24 % |
| Unclassified | root | N/A | 4.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10008650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3616 | Open in IMG/M |
| 3300002562|JGI25382J37095_10031184 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300002562|JGI25382J37095_10059178 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300005166|Ga0066674_10107073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1301 | Open in IMG/M |
| 3300005172|Ga0066683_10228916 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005174|Ga0066680_10027265 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300005181|Ga0066678_10177086 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005181|Ga0066678_11005006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300005451|Ga0066681_10403156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 840 | Open in IMG/M |
| 3300005540|Ga0066697_10330667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
| 3300005545|Ga0070695_100142487 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300005546|Ga0070696_100642429 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005553|Ga0066695_10458483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
| 3300005556|Ga0066707_10940337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300005568|Ga0066703_10018941 | All Organisms → cellular organisms → Bacteria | 3508 | Open in IMG/M |
| 3300005587|Ga0066654_10736843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300006034|Ga0066656_11033558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300006796|Ga0066665_10013092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4910 | Open in IMG/M |
| 3300006796|Ga0066665_11686197 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006797|Ga0066659_10019707 | All Organisms → cellular organisms → Bacteria | 3834 | Open in IMG/M |
| 3300006797|Ga0066659_11276609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300007265|Ga0099794_10496828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
| 3300009012|Ga0066710_100554639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1739 | Open in IMG/M |
| 3300009012|Ga0066710_102221017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 801 | Open in IMG/M |
| 3300009090|Ga0099827_11239830 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009090|Ga0099827_12021964 | Not Available | 500 | Open in IMG/M |
| 3300009137|Ga0066709_102009701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 801 | Open in IMG/M |
| 3300009162|Ga0075423_10120672 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300009162|Ga0075423_11383225 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010159|Ga0099796_10006532 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300010304|Ga0134088_10038155 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300010333|Ga0134080_10067781 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300010333|Ga0134080_10339123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
| 3300011269|Ga0137392_10042348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3382 | Open in IMG/M |
| 3300011269|Ga0137392_10379021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1173 | Open in IMG/M |
| 3300011271|Ga0137393_10518328 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300011441|Ga0137452_1106332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300012034|Ga0137453_1050224 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012175|Ga0137321_1086915 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
| 3300012200|Ga0137382_10238529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1258 | Open in IMG/M |
| 3300012201|Ga0137365_10198199 | All Organisms → cellular organisms → Bacteria → FCB group | 1501 | Open in IMG/M |
| 3300012201|Ga0137365_10700308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 740 | Open in IMG/M |
| 3300012203|Ga0137399_10055672 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
| 3300012203|Ga0137399_11519600 | Not Available | 557 | Open in IMG/M |
| 3300012204|Ga0137374_10126769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2334 | Open in IMG/M |
| 3300012206|Ga0137380_10165706 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300012208|Ga0137376_10073241 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300012208|Ga0137376_10353181 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012208|Ga0137376_11522352 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012209|Ga0137379_10384048 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300012211|Ga0137377_10054368 | All Organisms → cellular organisms → Bacteria | 3710 | Open in IMG/M |
| 3300012211|Ga0137377_10228733 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1786 | Open in IMG/M |
| 3300012211|Ga0137377_11706688 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012351|Ga0137386_10193178 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300012351|Ga0137386_10727236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 713 | Open in IMG/M |
| 3300012354|Ga0137366_11029949 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012359|Ga0137385_10047162 | All Organisms → cellular organisms → Bacteria | 3856 | Open in IMG/M |
| 3300012361|Ga0137360_10208258 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300012362|Ga0137361_11650278 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012363|Ga0137390_10614642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1054 | Open in IMG/M |
| 3300012469|Ga0150984_116253140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1270 | Open in IMG/M |
| 3300012683|Ga0137398_10722887 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300012925|Ga0137419_10241959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1356 | Open in IMG/M |
| 3300012925|Ga0137419_10423924 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1044 | Open in IMG/M |
| 3300012925|Ga0137419_11656377 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012927|Ga0137416_10338121 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300012927|Ga0137416_10495525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → Candidatus Nitrotoga arctica | 1051 | Open in IMG/M |
| 3300012944|Ga0137410_10911948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 744 | Open in IMG/M |
| 3300012944|Ga0137410_12077128 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012948|Ga0126375_11162066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
| 3300015051|Ga0137414_1154432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2152 | Open in IMG/M |
| 3300015241|Ga0137418_10495431 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300015359|Ga0134085_10178489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 909 | Open in IMG/M |
| 3300017654|Ga0134069_1155904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
| 3300017656|Ga0134112_10169005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 847 | Open in IMG/M |
| 3300017657|Ga0134074_1074817 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300017659|Ga0134083_10370510 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300017659|Ga0134083_10583791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300018433|Ga0066667_10706834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 846 | Open in IMG/M |
| 3300018468|Ga0066662_11383123 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018482|Ga0066669_10126392 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300019879|Ga0193723_1149388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300021073|Ga0210378_10052361 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1609 | Open in IMG/M |
| 3300024330|Ga0137417_1061917 | Not Available | 987 | Open in IMG/M |
| 3300026296|Ga0209235_1013969 | All Organisms → cellular organisms → Bacteria | 4404 | Open in IMG/M |
| 3300026296|Ga0209235_1074067 | Not Available | 1541 | Open in IMG/M |
| 3300026298|Ga0209236_1147151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1001 | Open in IMG/M |
| 3300026314|Ga0209268_1016426 | All Organisms → cellular organisms → Bacteria | 2806 | Open in IMG/M |
| 3300026320|Ga0209131_1125848 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300026320|Ga0209131_1406428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300026324|Ga0209470_1302289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300026327|Ga0209266_1053012 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300026327|Ga0209266_1269461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
| 3300026332|Ga0209803_1347167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300026335|Ga0209804_1237184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RIFCSPLOWO2_12_FULL_68_9 | 707 | Open in IMG/M |
| 3300026528|Ga0209378_1055237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1901 | Open in IMG/M |
| 3300026530|Ga0209807_1021923 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300026540|Ga0209376_1240404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 783 | Open in IMG/M |
| 3300026548|Ga0209161_10366383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
| 3300027875|Ga0209283_10899275 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028536|Ga0137415_10061032 | All Organisms → cellular organisms → Bacteria | 3636 | Open in IMG/M |
| 3300028711|Ga0307293_10273475 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028719|Ga0307301_10265528 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300028771|Ga0307320_10229683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 729 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100086506 | 3300002558 | Grasslands Soil | DGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHEPD* |
| JGI25382J37095_100311843 | 3300002562 | Grasslands Soil | TSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| JGI25382J37095_100591783 | 3300002562 | Grasslands Soil | PSRTVTSRLDAPVLNALVTVTNTRGESLFRARESFYWHAPD* |
| Ga0066674_101070731 | 3300005166 | Soil | VTIEGQFPSRSVTSRLDAPVLDAMVTVTNTRGETLFRARESFYWHEPD* |
| Ga0066683_102289163 | 3300005172 | Soil | RFTSRFVTSQLDAPVLSALITVTNTRGEVLYRARDSFRWHQPE* |
| Ga0066680_100272651 | 3300005174 | Soil | QFPSRSVTSRLDAPVLNALVTVTNTRGETLFRARESFYWHAPD* |
| Ga0066678_101770863 | 3300005181 | Soil | GIVVTIEGQFPSRTVTSRLDAQVLNAWVTVTNTRGETVFRARESFYWHTPD* |
| Ga0066678_110050062 | 3300005181 | Soil | RFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0066681_104031562 | 3300005451 | Soil | ERVGVVTIDGRFTSRFVTSSLDTPVLSALITITNTRGEILFSARESFYWHAPD* |
| Ga0066697_103306671 | 3300005540 | Soil | SSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0070695_1001424874 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YRVGMVTIDGRFNSRVVTGRLDMPALSALITVTNQRGEVLYRARDSFRWHGPE* |
| Ga0070696_1006424293 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QFPQRSVTSRLDAPVLNAWITITNTRGETVFRARESFLWHTPD* |
| Ga0066695_104584831 | 3300005553 | Soil | IMVTIEGQFPSRSVTSRLDAPVLNALVTITNTRGETLFSARESFYWHAPD* |
| Ga0066707_109403373 | 3300005556 | Soil | MVTIDGLFTSRFITSRLDTPVLSALITVTNTRGETLYQARDSFVWHAPD* |
| Ga0066703_100189415 | 3300005568 | Soil | PSRTVTSRLDAQVLNAWVTVTNTRGETLFRARESFYWHAPD* |
| Ga0066654_107368431 | 3300005587 | Soil | VTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0066656_110335582 | 3300006034 | Soil | VGVVTIDGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0066665_1001309210 | 3300006796 | Soil | TSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0066665_116861972 | 3300006796 | Soil | LESVGMVTIDGQFTSRSITNRLDAPVLNALITITNTRGETLFRARESFYWHAPD* |
| Ga0066659_100197071 | 3300006797 | Soil | PSRSVTSRLDAPVLNALVTITNTRGETLFSARESFYWHAPD* |
| Ga0066659_112766091 | 3300006797 | Soil | RLDAPVLDAMVTVTNTRGETLFRARESFYWHEPD* |
| Ga0099794_104968281 | 3300007265 | Vadose Zone Soil | GQFPSRSVTSRLDAPVLNAVVTFTNTRGETLFRARESFYWHAPD* |
| Ga0066710_1005546391 | 3300009012 | Grasslands Soil | GRFTSRFVTSQLDAPVLSALITVTNTRGEVLYRARDSFRWHEPD |
| Ga0066710_1022210173 | 3300009012 | Grasslands Soil | VTIEGQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHTPD |
| Ga0099827_112398301 | 3300009090 | Vadose Zone Soil | RVGIMVTIEGQFPSRSVTSRLDAPVLNALVTVTNTRGETLFRARESFYWHAPD* |
| Ga0099827_120219641 | 3300009090 | Vadose Zone Soil | TSRLDAPVLNALVTMTNTRGETLFRARESFYWHAPD* |
| Ga0066709_1020097013 | 3300009137 | Grasslands Soil | VTIEGQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHTPD* |
| Ga0075423_101206721 | 3300009162 | Populus Rhizosphere | PQRSVTSRLDALVLNAWITITNTRGETVFRARESFLWHAPDEDRPPSP* |
| Ga0075423_113832251 | 3300009162 | Populus Rhizosphere | IDGQFPQRSVTSHLDAPVLNATITVTNTRGETVFRARESFLWHTPD* |
| Ga0099796_100065327 | 3300010159 | Vadose Zone Soil | EGQFPSRSVTSRLDAQVLNAWITITNTRGETLFRARESFYWHAPD* |
| Ga0134088_100381553 | 3300010304 | Grasslands Soil | SRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0134080_100677814 | 3300010333 | Grasslands Soil | FERVGIMVTIEGQFPSRSVTSRLDAPVLDAMVTVTNTRGETLFRARQPFYWHAPD* |
| Ga0134080_103391232 | 3300010333 | Grasslands Soil | IEGQFPSRSVTSRLDAPVLNALVTVTNTRGETLFHARESFYWHAPD* |
| Ga0137392_100423481 | 3300011269 | Vadose Zone Soil | MVTIDGQFTSRSVTSRLDAPVLNALIRITNTRGETLFSARESFYWHAPD* |
| Ga0137392_103790211 | 3300011269 | Vadose Zone Soil | QFPSRSVTSRLDAPVLNAWITVTNTRGETVFRARESFLWHAPD* |
| Ga0137393_105183282 | 3300011271 | Vadose Zone Soil | TSRSVTSRLDAPVLNALITITNTRGETLFSARESFYWHAPD* |
| Ga0137452_11063321 | 3300011441 | Soil | IDGRFTSRVVTGRLDAPALSALITVTNPRGEVLYRARDSFRWHGPD* |
| Ga0137453_10502242 | 3300012034 | Soil | MVTIDGRFTSRFVTSRLDAPVLSALITITNTRGEVLYRARDTFRWHAPD* |
| Ga0137321_10869151 | 3300012175 | Soil | NRLDMPALSALITVTNTRGEVLYRARDSFRWHGPE* |
| Ga0137382_102385291 | 3300012200 | Vadose Zone Soil | SLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0137365_101981991 | 3300012201 | Vadose Zone Soil | IAVTIEGQFPLRSVTSSLDAPVLNALVTVTNTRGETLFRARESFYWHEPD* |
| Ga0137365_107003081 | 3300012201 | Vadose Zone Soil | TSRFATSQLDAPVLSALITITNTRGEVLYRAHDTFRWHEPD* |
| Ga0137399_100556727 | 3300012203 | Vadose Zone Soil | TIDGQFTSRSLTSRLDAPVLNALITVTNTRGETMFNARESFYWHAPD* |
| Ga0137399_115196002 | 3300012203 | Vadose Zone Soil | SVTSRLDAPVLNAMVTVTNTRGETLFRARQPFYWHAPD* |
| Ga0137374_101267695 | 3300012204 | Vadose Zone Soil | VTIDGQFPSRSVTSRLDAPVLDALITITNTRGETLFRARESFYWHAPD* |
| Ga0137380_101657063 | 3300012206 | Vadose Zone Soil | SVTSSLDAPVLNAMITITNTRGETLFRARESFYWHAPD* |
| Ga0137376_100732414 | 3300012208 | Vadose Zone Soil | GIMVTIEGQFPSRSVTSRLDAPVLNAMVTVTNTRGETLFRARQPFYWHAPD* |
| Ga0137376_103531813 | 3300012208 | Vadose Zone Soil | SRLDAQVLNAWVTVTNTRGETLFRARESFYWHAPD* |
| Ga0137376_115223522 | 3300012208 | Vadose Zone Soil | SQLDAPVLSALITVTNTRGEVLYRARDSFRWHEPD* |
| Ga0137379_103840481 | 3300012209 | Vadose Zone Soil | RVGVVTIDGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0137377_100543681 | 3300012211 | Vadose Zone Soil | GQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHAPD* |
| Ga0137377_102287334 | 3300012211 | Vadose Zone Soil | GQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHTPD* |
| Ga0137377_117066881 | 3300012211 | Vadose Zone Soil | IEGQFPSRSVTSRLDAPVLDALVTLTNTRGETLFRARQSFYWHAPD* |
| Ga0137386_101931781 | 3300012351 | Vadose Zone Soil | QFPSRSVTSRLDAPVLNALVTLTNTRGETLFRARESFYWHEPD* |
| Ga0137386_107272362 | 3300012351 | Vadose Zone Soil | VTSSLDTPVLSALITITNTRGETLFSARESFYWHSPD* |
| Ga0137366_110299491 | 3300012354 | Vadose Zone Soil | SLDAPALNAMITITNTRGETLFRARESFYSHAPD* |
| Ga0137385_100471621 | 3300012359 | Vadose Zone Soil | TIDGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD* |
| Ga0137360_102082583 | 3300012361 | Vadose Zone Soil | ERVGIVVTIEGQFPSRTVTSRLDAQVLNAWVTVTNTRGETVFRARESFYWHTPD* |
| Ga0137361_116502781 | 3300012362 | Vadose Zone Soil | SRLDAQVLNAWVTVTNTRGETVFRARESFYWHTPD* |
| Ga0137390_106146421 | 3300012363 | Vadose Zone Soil | FERVGIAVTIEGQFPSRSVTSRLDAQVLNAWITITNTRGETLFRARESFYWHAPD* |
| Ga0150984_1162531403 | 3300012469 | Avena Fatua Rhizosphere | LEGVGIVTIDGQFPARTVTSRLDAPVLNAVVTFTNPRGETLFRARESFYWHTPD* |
| Ga0137398_107228871 | 3300012683 | Vadose Zone Soil | SRLDAPVLNAMVTVTNTRGETLFRARQPFYWHAPD* |
| Ga0137419_102419591 | 3300012925 | Vadose Zone Soil | TSRLDAQVLNAWVTVTNTRGETLFRARESFYWHAPD* |
| Ga0137419_104239241 | 3300012925 | Vadose Zone Soil | RVGIVVTIEGQFPSRTVTSRLDAPVLDGMVTVTNTRGETLFRARQPFYWHAPE* |
| Ga0137419_116563772 | 3300012925 | Vadose Zone Soil | DGQFPSRSVTSRLDAPVLNALVTITNTRGETLFRARQSFYWHAPD* |
| Ga0137416_103381212 | 3300012927 | Vadose Zone Soil | SRSVTSRLDAPVLNAWVTVTNTRGETVFRARESFYWHTPD* |
| Ga0137416_104955251 | 3300012927 | Vadose Zone Soil | TIDGQFPSRSVTSRLDAPVLNALITITNTRGETLFRARESFYWHSPD* |
| Ga0137410_109119481 | 3300012944 | Vadose Zone Soil | VTIEGQFPSRSVTSRLDAQVLNAWITITNTRGETLFRARESFYWHAPD* |
| Ga0137410_120771282 | 3300012944 | Vadose Zone Soil | IEGQFPSRTVTSRLDAPVLDGMVTVTNTRGETLFRARQPFYWHAPE* |
| Ga0126375_111620661 | 3300012948 | Tropical Forest Soil | IDGRFPSRFATSRLDAPVLTAVITVTSQRGEVLYRARDSFTWHEPD* |
| Ga0137414_11544322 | 3300015051 | Vadose Zone Soil | MVTIEGQFPSRSVTSRLDAPVLNAMVTVTNTRGETLFRARQPFYWHAPD* |
| Ga0137418_104954312 | 3300015241 | Vadose Zone Soil | RTVTSRLDAQVLNAWVTVTNTRGETVFRARESFYWHAPD* |
| Ga0134085_101784891 | 3300015359 | Grasslands Soil | FERVGIMVTIEGQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHEPD* |
| Ga0134069_11559042 | 3300017654 | Grasslands Soil | ERVGVVTIDGRFTSRYVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0134112_101690052 | 3300017656 | Grasslands Soil | ERVGIVVTIEGQFPSRSVTSRLDAPVLNALVTVTNTRGETLFHARESFYWHAPD |
| Ga0134074_10748173 | 3300017657 | Grasslands Soil | FTSRFVTSQLDAPVLSALITVTNTRGEVLYRARDSFRWHEPD |
| Ga0134083_103705102 | 3300017659 | Grasslands Soil | FASRYASNRLDMPALSALITVTNTRGEVLYRARDSFNWHVPDQMGSP |
| Ga0134083_105837911 | 3300017659 | Grasslands Soil | VTIEGQFPSRSVTSRLDAPVLNALVTVTNTRGETLFHARESFYWHAPD |
| Ga0184612_100063808 | 3300018078 | Groundwater Sediment | TSRLDAPVLSASITITNTRGEILYRARDSFRWHAPD |
| Ga0066667_107068342 | 3300018433 | Grasslands Soil | RSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHEPD |
| Ga0066662_113831232 | 3300018468 | Grasslands Soil | ELDRVGMVTIDRRFTSRFVTSRLDQPVLSAWITISNTRGETLYRARDSFVWHAPD |
| Ga0066669_101263924 | 3300018482 | Grasslands Soil | VTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0193723_11493881 | 3300019879 | Soil | FERVGIVVTIDGQFPQRSVTSHLDAPVLNAWITITNTRGETVFRARESFLWHAPD |
| Ga0210378_100523612 | 3300021073 | Groundwater Sediment | DGRFTSGFVTSRLDAPVLSASITITNTRGEILYRARDSFRWPAPD |
| Ga0137417_10619171 | 3300024330 | Vadose Zone Soil | VTSSLDTPVLSALITITNTRGETLFSARESFYWHPPD |
| Ga0209235_10139696 | 3300026296 | Grasslands Soil | ERVGVVTIDGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0209235_10740672 | 3300026296 | Grasslands Soil | ERVGVVTIDGRFTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHEPD |
| Ga0209236_11471512 | 3300026298 | Grasslands Soil | MVTIEGQFPSRSVTSRLDAPVLDALVTVANTRGETLFRARESFYWHAPD |
| Ga0209268_10164264 | 3300026314 | Soil | DGRRTSRFVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0209131_11258481 | 3300026320 | Grasslands Soil | VGIMVTIEGQFPSRSVTSRLDAPVLNAMVTVTNTRGETLFRARQPFYWHAPD |
| Ga0209131_14064281 | 3300026320 | Grasslands Soil | ERVGIVVTIEGQFPSRTVTSRLDAPVLDGMVTVTNTRGETLFRARQPFYWHAPE |
| Ga0209470_13022891 | 3300026324 | Soil | FPSRSVTSRLDAPVLNALVTVTNTRGETLFHARESFYWHAPD |
| Ga0209266_10530121 | 3300026327 | Soil | IEGQFPSRSVTSRLDAPVLDAMVTVTNTRGETLFRARQPFYWHAPD |
| Ga0209266_12694612 | 3300026327 | Soil | VGIMVTIEGQFPSRSVTSRLDAPVLNAVVTVTNTRGETLFRARESFYWHTPD |
| Ga0209803_13471671 | 3300026332 | Soil | VGVVTIDGRFTSRYVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0209804_12371841 | 3300026335 | Soil | TSRLDTPVLSALITITNTRGETLYQARESFYWHTPD |
| Ga0209378_10552371 | 3300026528 | Soil | VTIDGRFTSRYVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0209807_10219235 | 3300026530 | Soil | TIDGQFPSRSVTSRLDAPVLNAWITVTNTRGETVFRARESFLWHAPD |
| Ga0209376_12404041 | 3300026540 | Soil | EGQFPSRSVTSRLDAPVLNALVTVTNTRGETLFHARESFYWHAPD |
| Ga0209161_103663831 | 3300026548 | Soil | VVTIDGRFTSRYVTSSLDTPVLSALITITNTRGETLFSARESFYWHAPD |
| Ga0209283_108992752 | 3300027875 | Vadose Zone Soil | RSVTSRLDAPVLNALVTMTNTRGETLFRARESFYWHAPD |
| Ga0137415_100610321 | 3300028536 | Vadose Zone Soil | MVTIDGQFPSRSVTSRLDAPVLNALITITNTRGETLFRARESFYWHSPD |
| Ga0307293_102734752 | 3300028711 | Soil | VVTIDGQFPQRSVTSHLDAPVLNAWITITNTRGETVFRARESFLWHTPD |
| Ga0307301_102655281 | 3300028719 | Soil | VVTIEGQFPSRSVTSRLDAPVLDAMVTITNTRGETLFRARQPFYWHAPD |
| Ga0307320_102296831 | 3300028771 | Soil | GIVVTIDGQFPQRSVTSHLDAPVLNAWITITNTRGETVFRARESFLWHTPD |
| ⦗Top⦘ |