| Basic Information | |
|---|---|
| Family ID | F095230 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MEVLMTVLILVLLAMLAAKWGVDSRPIDADRPTRWWPATPRD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.00 % |
| % of genes near scaffold ends (potentially truncated) | 22.86 % |
| % of genes from short scaffolds (< 2000 bps) | 68.57 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.476 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 28.57 |
| PF00126 | HTH_1 | 13.33 |
| PF01547 | SBP_bac_1 | 12.38 |
| PF07690 | MFS_1 | 8.57 |
| PF05977 | MFS_3 | 3.81 |
| PF01872 | RibD_C | 2.86 |
| PF13416 | SBP_bac_8 | 1.90 |
| PF13189 | Cytidylate_kin2 | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF11846 | Wzy_C_2 | 0.95 |
| PF08281 | Sigma70_r4_2 | 0.95 |
| PF13424 | TPR_12 | 0.95 |
| PF01663 | Phosphodiest | 0.95 |
| PF13302 | Acetyltransf_3 | 0.95 |
| PF00196 | GerE | 0.95 |
| PF00931 | NB-ARC | 0.95 |
| PF13191 | AAA_16 | 0.95 |
| PF12847 | Methyltransf_18 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 3.81 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.86 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.86 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.33 % |
| Unclassified | root | N/A | 6.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01ETVK9 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300000956|JGI10216J12902_116621615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300002561|JGI25384J37096_10015220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2977 | Open in IMG/M |
| 3300005172|Ga0066683_10022630 | All Organisms → cellular organisms → Bacteria | 3537 | Open in IMG/M |
| 3300005175|Ga0066673_10118810 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300005178|Ga0066688_10112541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1674 | Open in IMG/M |
| 3300005179|Ga0066684_10061999 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300005187|Ga0066675_10003962 | All Organisms → cellular organisms → Bacteria | 7057 | Open in IMG/M |
| 3300005187|Ga0066675_10201051 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300005406|Ga0070703_10010679 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300005434|Ga0070709_10551082 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005440|Ga0070705_100995652 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005445|Ga0070708_100073186 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
| 3300005451|Ga0066681_10248361 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005468|Ga0070707_100004458 | All Organisms → cellular organisms → Bacteria | 13110 | Open in IMG/M |
| 3300005468|Ga0070707_100402264 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005518|Ga0070699_101192893 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005536|Ga0070697_100442652 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005536|Ga0070697_100517252 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005540|Ga0066697_10006259 | All Organisms → cellular organisms → Bacteria | 5868 | Open in IMG/M |
| 3300005540|Ga0066697_10041796 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
| 3300005540|Ga0066697_10444743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300005545|Ga0070695_100747990 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005546|Ga0070696_101072031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300005552|Ga0066701_10029596 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300005555|Ga0066692_10034919 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300005561|Ga0066699_10159806 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300005566|Ga0066693_10297165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300005568|Ga0066703_10081169 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300005569|Ga0066705_10265571 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300005586|Ga0066691_10752399 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006032|Ga0066696_11053581 | Not Available | 517 | Open in IMG/M |
| 3300006796|Ga0066665_10037911 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300006852|Ga0075433_10279239 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300006854|Ga0075425_102549601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300007076|Ga0075435_100308602 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300007255|Ga0099791_10143419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1114 | Open in IMG/M |
| 3300007258|Ga0099793_10027174 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300009012|Ga0066710_100289458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2393 | Open in IMG/M |
| 3300009012|Ga0066710_102362862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 772 | Open in IMG/M |
| 3300009012|Ga0066710_102872065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300009012|Ga0066710_103884646 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009012|Ga0066710_104654289 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009090|Ga0099827_10292493 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300009137|Ga0066709_103046283 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009162|Ga0075423_10080711 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300009162|Ga0075423_10199033 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300009162|Ga0075423_11688574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300010322|Ga0134084_10426222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300010335|Ga0134063_10040203 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300010335|Ga0134063_10175792 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300010337|Ga0134062_10019955 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300010373|Ga0134128_12337211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300010396|Ga0134126_11078080 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300010398|Ga0126383_13112371 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010895|Ga0138113_156975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300012096|Ga0137389_10090124 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
| 3300012200|Ga0137382_10075014 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300012203|Ga0137399_10410536 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300012203|Ga0137399_11194768 | Not Available | 640 | Open in IMG/M |
| 3300012204|Ga0137374_10239905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1528 | Open in IMG/M |
| 3300012211|Ga0137377_10004486 | All Organisms → cellular organisms → Bacteria | 11001 | Open in IMG/M |
| 3300012351|Ga0137386_10647512 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012353|Ga0137367_10353960 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012354|Ga0137366_10951254 | Not Available | 601 | Open in IMG/M |
| 3300012355|Ga0137369_10012420 | All Organisms → cellular organisms → Bacteria | 8301 | Open in IMG/M |
| 3300012355|Ga0137369_10029404 | All Organisms → cellular organisms → Bacteria | 5058 | Open in IMG/M |
| 3300012355|Ga0137369_10635942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300012361|Ga0137360_10488905 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300012382|Ga0134038_1092000 | Not Available | 729 | Open in IMG/M |
| 3300012383|Ga0134033_1114122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300012400|Ga0134048_1087903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300012407|Ga0134050_1100138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300012944|Ga0137410_11460614 | Not Available | 596 | Open in IMG/M |
| 3300012977|Ga0134087_10009937 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
| 3300014166|Ga0134079_10544031 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300015245|Ga0137409_10589237 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300018431|Ga0066655_10038397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2392 | Open in IMG/M |
| 3300018431|Ga0066655_10480269 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300018431|Ga0066655_10946923 | Not Available | 591 | Open in IMG/M |
| 3300018433|Ga0066667_10437823 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300018433|Ga0066667_10697461 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300018468|Ga0066662_10001046 | All Organisms → cellular organisms → Bacteria | 12462 | Open in IMG/M |
| 3300018468|Ga0066662_10125357 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300018482|Ga0066669_10125944 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300025885|Ga0207653_10221015 | Not Available | 719 | Open in IMG/M |
| 3300025922|Ga0207646_10008211 | All Organisms → cellular organisms → Bacteria | 10491 | Open in IMG/M |
| 3300025922|Ga0207646_10086319 | All Organisms → cellular organisms → Bacteria | 2807 | Open in IMG/M |
| 3300026297|Ga0209237_1103982 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300026298|Ga0209236_1001334 | All Organisms → cellular organisms → Bacteria | 14830 | Open in IMG/M |
| 3300026313|Ga0209761_1032784 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300026316|Ga0209155_1013794 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300026322|Ga0209687_1199096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
| 3300026343|Ga0209159_1179541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300026530|Ga0209807_1022782 | All Organisms → cellular organisms → Bacteria | 3046 | Open in IMG/M |
| 3300026548|Ga0209161_10328694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300026552|Ga0209577_10173735 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300027882|Ga0209590_10758592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300028536|Ga0137415_10006905 | All Organisms → cellular organisms → Bacteria | 11264 | Open in IMG/M |
| 3300031720|Ga0307469_10573147 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031740|Ga0307468_100104788 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300031740|Ga0307468_101153806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300032180|Ga0307471_100698685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1179 | Open in IMG/M |
| 3300032180|Ga0307471_103549158 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032205|Ga0307472_102509563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010895 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06045940 | 2170459005 | Grass Soil | MEVLMTVLILALLAMLAEKLGADSRPLDIDRPTRWWPATPRD |
| JGI10216J12902_1166216152 | 3300000956 | Soil | NTQCMEVLMALLMLVLLALCAWRWGVDSRPSDADRPTRWWPATPRD* |
| JGI25384J37096_100152202 | 3300002561 | Grasslands Soil | MELVMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066683_100226306 | 3300005172 | Soil | MEVFMTVLVFVLLALCAARWGVDSRPVDADRATRWWPATPRE* |
| Ga0066673_101188103 | 3300005175 | Soil | MEVLMSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066688_101125411 | 3300005178 | Soil | LIAVMLLLLLALCAGRWGADSRPQDVDRATPWWPATPRE* |
| Ga0066684_100619992 | 3300005179 | Soil | MEVLMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0066675_100039622 | 3300005187 | Soil | VEILMAVLVLLLLALCAGHWGADSRPQDVDRATPWWPATPRE* |
| Ga0066675_102010512 | 3300005187 | Soil | MEVLMTVLIMVLLAMLAAGWGADSRPLDIDRPTPWWPATPRD* |
| Ga0070703_100106791 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMALLILALIVLCTWRWGVDSRPIDADRATRWWPATPRD* |
| Ga0070709_105510821 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMSLLIVVLLVMCAARWGADSRPIDADRPTRWWPATPREN* |
| Ga0070705_1009956522 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MCMELLMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0070708_1000731864 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFLMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066681_102483611 | 3300005451 | Soil | MEVLMSLLIVLLLVMCAARWGADSRPVDADRPTRWWPATPRED |
| Ga0070707_1000044584 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLVAVLMFVLLALLTARWGVDSRPIDAERPTRWWPATPRD* |
| Ga0070707_1004022642 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMALLILALLVVCAWRWGVDSRPIDADRATRWWPATPRD* |
| Ga0070699_1011928932 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MELLMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0070697_1004426521 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLLLVLVLVLLAMAAAKWGVDSRPLDIDRPTPWWPATPRD* |
| Ga0070697_1005172522 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMAVLMFVLLALLTARWGVDSRPIDAERPTRWWPAIPRD* |
| Ga0066697_100062594 | 3300005540 | Soil | MAVLVLLLLALCAGHWGADSRPQDVDRATPWWPATPRE* |
| Ga0066697_100417962 | 3300005540 | Soil | MTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066697_104447432 | 3300005540 | Soil | MEVLMTVLILVLLAMLAARWGVDSRPLDIDRPTPWWPATPRD* |
| Ga0070695_1007479901 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMSLLIVVLLAMCAARWGADSRPIDADRPTRWWPATPREN* |
| Ga0070696_1010720311 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLMTVLILVLLAMLAAKWGVDSRPLDADRPTRWWPATPRD* |
| Ga0066701_100295962 | 3300005552 | Soil | MAVLALLLLALCAGQWGADSRAQDVDRATPWWPATPRE* |
| Ga0066692_100349194 | 3300005555 | Soil | MAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0066699_101598062 | 3300005561 | Soil | MAVLLLILLAMVAVRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0066693_102971652 | 3300005566 | Soil | VLMTVLILVLLAMLAEGWGAHSRPLDIDRPTPWWPATPRD* |
| Ga0066703_100811691 | 3300005568 | Soil | FDPGKPICMELVMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066705_102655712 | 3300005569 | Soil | MSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0066691_107523992 | 3300005586 | Soil | MEALMAILLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0066696_110535811 | 3300006032 | Soil | MTVLILVLLAMLAEGWGADSRPLDIDRPTPWWPATPRD* |
| Ga0066665_100379112 | 3300006796 | Soil | MAILLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0075433_102792392 | 3300006852 | Populus Rhizosphere | MTVLVALALVMLVARWGVDSRLPDADRATPWWPATPRD* |
| Ga0075425_1025496012 | 3300006854 | Populus Rhizosphere | LKPMEVLMTVLILVVLAMFAAKWGVDSRPLDTDRATPWWPATPRD* |
| Ga0075435_1003086022 | 3300007076 | Populus Rhizosphere | MTVLILVVLAMFAAKWGVDSRPLDTDRATPWWPATPRD* |
| Ga0099791_101434192 | 3300007255 | Vadose Zone Soil | MEVLVALLIAILLALLAVRWGVDSRPADVDRTTRWWPATPRD* |
| Ga0099793_100271743 | 3300007258 | Vadose Zone Soil | MEVLMVLLLTLLLAVLAVRWGVDSRPVDAERATRWWPATPRD* |
| Ga0066710_1002894582 | 3300009012 | Grasslands Soil | MTVLIMVLLAMLAAGWGADSRPLDIDRPTPWWPATPRD |
| Ga0066710_1023628622 | 3300009012 | Grasslands Soil | MTVLMLVLLAMLAAGWGVDSRPLDIDRPTPWWPATPRD |
| Ga0066710_1028720652 | 3300009012 | Grasslands Soil | GKTEVMEALMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD |
| Ga0066710_1038846461 | 3300009012 | Grasslands Soil | MEVFMTVLVFVLLALCAARWGVDSRPVDADRATRWWPATPRE |
| Ga0066710_1046542891 | 3300009012 | Grasslands Soil | VEILIAVMLLLLLALCAGRWGADSRPQDVDRATPWWP |
| Ga0099827_102924932 | 3300009090 | Vadose Zone Soil | MEVLMSLLILVLVAMSAARWGADSRPIDADRPTHWWPATPRD* |
| Ga0066709_1030462832 | 3300009137 | Grasslands Soil | MEVLMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPA |
| Ga0075423_100807113 | 3300009162 | Populus Rhizosphere | MEVFMSVLLFVLLALCAARWGVDSRPIDADRATRWWPATPRD* |
| Ga0075423_101990334 | 3300009162 | Populus Rhizosphere | MEVLMTVLVALALVMLVARWGVDSRLPDADRATPWWPATPRD* |
| Ga0075423_116885742 | 3300009162 | Populus Rhizosphere | MEVLMTVLILVLLAMGAAKWGVDSRPLDIDRPTRWWPATPRD* |
| Ga0134084_104262221 | 3300010322 | Grasslands Soil | MEVLMTVLILVLLAMLAEGWGADSRPLDIDRPTPWWPATPRD* |
| Ga0134063_100402033 | 3300010335 | Grasslands Soil | VMEALMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD* |
| Ga0134063_101757921 | 3300010335 | Grasslands Soil | MEIVMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0134062_100199553 | 3300010337 | Grasslands Soil | MAVLVLLLLALCAGQWGADSRAQDVDRATPWWPATPRE* |
| Ga0134128_123372111 | 3300010373 | Terrestrial Soil | MEVLMTVLVLGVLAIVAATWGVDSRPLDTERPTPWWPATPRD* |
| Ga0134126_110780802 | 3300010396 | Terrestrial Soil | MALLMLVLLALCAARWGVDSRPTDADRATSWWPATPRD* |
| Ga0126383_131123711 | 3300010398 | Tropical Forest Soil | MEVFMAVLVMLLLALCAALWAVDSRPADVERATRWWPATPRD* |
| Ga0138113_1569752 | 3300010895 | Grasslands Soil | VLLLLALCAGQWGADSRAQDVDRATPWWPATPRE* |
| Ga0137389_100901243 | 3300012096 | Vadose Zone Soil | MEVLMVLLLTLLLAVLAVRWGVDSRPIDAERATRWWPATPRD* |
| Ga0137382_100750142 | 3300012200 | Vadose Zone Soil | MEVLMSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPPD* |
| Ga0137399_104105362 | 3300012203 | Vadose Zone Soil | MEVLMVLLLTLLLAVLAVRWGVDSRPVDAERATGWWPATPRD* |
| Ga0137399_111947682 | 3300012203 | Vadose Zone Soil | MEVLMAVLVIVLLVMLSARWGVDSRPTDADRPTSWWPATPRD* |
| Ga0137374_102399052 | 3300012204 | Vadose Zone Soil | MEVLITVLILVLLATLAAKFGADSRPLDIDRPTRWWPATPRD* |
| Ga0137377_100044865 | 3300012211 | Vadose Zone Soil | MAVLALLLLALCAGHWGADSRPQDVDRATPWWPATPRE* |
| Ga0137386_106475122 | 3300012351 | Vadose Zone Soil | GKPICMEIVMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0137367_103539602 | 3300012353 | Vadose Zone Soil | MEVLMAALILVLVAMLAAAWGVDSRPTDAERATRWWPATPRD* |
| Ga0137366_109512542 | 3300012354 | Vadose Zone Soil | LMTVLILVLLATLAANLGADSRPLDIDRPTRWWPAAPRD* |
| Ga0137369_100124204 | 3300012355 | Vadose Zone Soil | MEVLMAALILVLVAMLAAAWGADSRPTDAERATRWWPATPRD* |
| Ga0137369_100294042 | 3300012355 | Vadose Zone Soil | MELLMALLMLVLLALCAGRWGVDSRPTDADRPTRWWPATPQD* |
| Ga0137369_106359422 | 3300012355 | Vadose Zone Soil | MELLMALLMLVLLTLCAGRWGVDSRPTDADRPTRWWPATPRD* |
| Ga0137360_104889051 | 3300012361 | Vadose Zone Soil | MDVASEFDPGKTDGMEVLMSLLILVLVAMSAARWGADSRPIDADRPTHWWPATPRD* |
| Ga0134038_10920001 | 3300012382 | Grasslands Soil | LVIVLLVLLSARWGVDSRPADADRPTSWWPATPRD* |
| Ga0134033_11141222 | 3300012383 | Grasslands Soil | GVEILMAVLVLLLLALCAGHWGADSRPQDVDRATPWWPATPRE* |
| Ga0134048_10879032 | 3300012400 | Grasslands Soil | LVLLLLALCAGHWGADSRPQDVDRATPWWPATPRE* |
| Ga0134050_11001381 | 3300012407 | Grasslands Soil | LILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0137410_114606141 | 3300012944 | Vadose Zone Soil | TQVMEVLMAVLVIVLLVMLSVRWGVDSRPTDADRPTSWWPATPRD* |
| Ga0134087_100099372 | 3300012977 | Grasslands Soil | MAVLLLLLLALCAGRWSVDSRPQDVDRATPWWPATPRE* |
| Ga0134079_105440312 | 3300014166 | Grasslands Soil | ANAMEVLMSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD* |
| Ga0137409_105892372 | 3300015245 | Vadose Zone Soil | MEVLMAVLILILLALLAGRWGVDSRPVDAERPTRWFAATPRD* |
| Ga0066655_100383974 | 3300018431 | Grasslands Soil | MAVLALLLLALCAGQWGADSRAQDVDRATPWWPATPRE |
| Ga0066655_104802691 | 3300018431 | Grasslands Soil | MEVLMTVLIMVLLAMLAAGWGADSRPLDIDRPTPWWPATPRD |
| Ga0066655_109469232 | 3300018431 | Grasslands Soil | MTVLILVLLAMLAARWGVDSRPLDIDRPTPWWPATPRD |
| Ga0066667_104378232 | 3300018433 | Grasslands Soil | MTLLILVLVAMCAARWGADSRPIDADRPTRWWPAT |
| Ga0066667_106974612 | 3300018433 | Grasslands Soil | MSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD |
| Ga0066662_1000104611 | 3300018468 | Grasslands Soil | MTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD |
| Ga0066662_101253572 | 3300018468 | Grasslands Soil | MAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD |
| Ga0066669_101259443 | 3300018482 | Grasslands Soil | MEVLMSLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD |
| Ga0207653_102210152 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MALLILALIVLCTWRWGVDSRPIDADRATRWWPATPRD |
| Ga0207646_100082118 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLVAVLMFVLLALLTARWGVDSRPIDAERPTRWWPATPRD |
| Ga0207646_100863193 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MALLILALLVLCTWRWGVDSRPIDADRATRWWPATPRD |
| Ga0209237_11039822 | 3300026297 | Grasslands Soil | MEALMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD |
| Ga0209236_100133415 | 3300026298 | Grasslands Soil | MELVMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD |
| Ga0209761_10327842 | 3300026313 | Grasslands Soil | MELLMTLLILVLVAMCAARWGADSRPIDADRPTRWWPATPRD |
| Ga0209155_10137944 | 3300026316 | Soil | MAVLVLLLLALCAGHWGADSRPQDVDRATPWWPATPRE |
| Ga0209687_11990962 | 3300026322 | Soil | AVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD |
| Ga0209159_11795412 | 3300026343 | Soil | MEVLMTVLILVLLAMLAARWGVDSRPLDIDRPTPWWPATPRD |
| Ga0209807_10227824 | 3300026530 | Soil | MAVLALLLLALCAGQWGADSRPQDVDRATPWWPATPRE |
| Ga0209161_103286941 | 3300026548 | Soil | KTEVMEVLMAVLLLILLAMLAMRWGVDSRPVDAERPTRWWPATPRD |
| Ga0209577_101737353 | 3300026552 | Soil | MAVLLLILLAMVAVRWGVDSRPVDAERPTRWWPATPRD |
| Ga0209590_107585922 | 3300027882 | Vadose Zone Soil | GNTESMEVLMAVLILVLAAMFAARWGVDSRPVDADRATRWWPAAPRD |
| Ga0137415_100069059 | 3300028536 | Vadose Zone Soil | MVLLLTLLLAVLAVRWGVDSRPVDAERATRWWPATPRD |
| Ga0307469_105731472 | 3300031720 | Hardwood Forest Soil | MEVLMTVLILVLLAMLAAKWGVDSRPIDADRPTRWWPATPRD |
| Ga0307468_1001047882 | 3300031740 | Hardwood Forest Soil | MTVLVALALVVLAAKWGVDSRPADADRATPWWPATPRD |
| Ga0307468_1011538061 | 3300031740 | Hardwood Forest Soil | MTVLILVLLAMLAAKWGVDSRPLDADRPTRWWPATPRD |
| Ga0307471_1006986852 | 3300032180 | Hardwood Forest Soil | MEVLMAVLMFVLLALLTARWGVDSRPIDAQRPTRWWPATPRD |
| Ga0307471_1035491581 | 3300032180 | Hardwood Forest Soil | MEVLMSLLIVVLLAMCAARWGADSRPIDADRPTRWWPATPREN |
| Ga0307472_1025095631 | 3300032205 | Hardwood Forest Soil | MEVLMTILILVLLAMCAAKWGVDSRPLDTDRATRWWPATPRD |
| ⦗Top⦘ |