| Basic Information | |
|---|---|
| Family ID | F095180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | HMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.85 % |
| % of genes near scaffold ends (potentially truncated) | 92.38 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.190 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.55% β-sheet: 0.00% Coil/Unstructured: 79.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 1.90 |
| PF00106 | adh_short | 1.90 |
| PF13378 | MR_MLE_C | 1.90 |
| PF04014 | MazE_antitoxin | 1.90 |
| PF07690 | MFS_1 | 1.90 |
| PF02082 | Rrf2 | 1.90 |
| PF12704 | MacB_PCD | 1.90 |
| PF02518 | HATPase_c | 1.90 |
| PF07969 | Amidohydro_3 | 0.95 |
| PF09517 | RE_Eco29kI | 0.95 |
| PF13468 | Glyoxalase_3 | 0.95 |
| PF12543 | DUF3738 | 0.95 |
| PF02449 | Glyco_hydro_42 | 0.95 |
| PF07589 | PEP-CTERM | 0.95 |
| PF06315 | AceK_kinase | 0.95 |
| PF07676 | PD40 | 0.95 |
| PF13751 | DDE_Tnp_1_6 | 0.95 |
| PF14534 | DUF4440 | 0.95 |
| PF01148 | CTP_transf_1 | 0.95 |
| PF13632 | Glyco_trans_2_3 | 0.95 |
| PF10387 | DUF2442 | 0.95 |
| PF02687 | FtsX | 0.95 |
| PF13505 | OMP_b-brl | 0.95 |
| PF00171 | Aldedh | 0.95 |
| PF10604 | Polyketide_cyc2 | 0.95 |
| PF05685 | Uma2 | 0.95 |
| PF01738 | DLH | 0.95 |
| PF00072 | Response_reg | 0.95 |
| PF04255 | DUF433 | 0.95 |
| PF07452 | CHRD | 0.95 |
| PF03551 | PadR | 0.95 |
| PF05222 | AlaDh_PNT_N | 0.95 |
| PF12680 | SnoaL_2 | 0.95 |
| PF01035 | DNA_binding_1 | 0.95 |
| PF13646 | HEAT_2 | 0.95 |
| PF00174 | Oxidored_molyb | 0.95 |
| PF01850 | PIN | 0.95 |
| PF01575 | MaoC_dehydratas | 0.95 |
| PF08547 | CIA30 | 0.95 |
| PF02826 | 2-Hacid_dh_C | 0.95 |
| PF14559 | TPR_19 | 0.95 |
| PF03404 | Mo-co_dimer | 0.95 |
| PF13714 | PEP_mutase | 0.95 |
| PF02634 | FdhD-NarQ | 0.95 |
| PF00005 | ABC_tran | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 1.90 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 1.90 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 1.90 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 1.90 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 1.90 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 1.90 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.90 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.90 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.95 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.95 |
| COG4579 | Isocitrate dehydrogenase kinase/phosphatase | Signal transduction mechanisms [T] | 0.95 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.95 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.95 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.95 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.95 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.95 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.95 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.95 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.95 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.19 % |
| Unclassified | root | N/A | 3.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003298|Ga0006841J48915_113992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 577 | Open in IMG/M |
| 3300004619|Ga0068953_1357549 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005332|Ga0066388_104498965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300005355|Ga0070671_100637442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 922 | Open in IMG/M |
| 3300006800|Ga0066660_11061387 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 645 | Open in IMG/M |
| 3300009093|Ga0105240_10940839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 927 | Open in IMG/M |
| 3300009177|Ga0105248_10173181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2433 | Open in IMG/M |
| 3300009635|Ga0116117_1120254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22 | 665 | Open in IMG/M |
| 3300009636|Ga0116112_1045520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1317 | Open in IMG/M |
| 3300009700|Ga0116217_10127933 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300009759|Ga0116101_1168377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 545 | Open in IMG/M |
| 3300010048|Ga0126373_11840230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 669 | Open in IMG/M |
| 3300010358|Ga0126370_10009058 | All Organisms → cellular organisms → Bacteria | 5227 | Open in IMG/M |
| 3300010361|Ga0126378_11967035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 666 | Open in IMG/M |
| 3300010376|Ga0126381_102116357 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010379|Ga0136449_101684593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 957 | Open in IMG/M |
| 3300010379|Ga0136449_103705225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300011045|Ga0138598_144855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 569 | Open in IMG/M |
| 3300012210|Ga0137378_11364062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300012212|Ga0150985_118225013 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012362|Ga0137361_11256369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300013306|Ga0163162_11337919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300014155|Ga0181524_10189305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300014161|Ga0181529_10039941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3438 | Open in IMG/M |
| 3300014164|Ga0181532_10038245 | All Organisms → cellular organisms → Bacteria | 3261 | Open in IMG/M |
| 3300014167|Ga0181528_10018139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4113 | Open in IMG/M |
| 3300014167|Ga0181528_10299750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 870 | Open in IMG/M |
| 3300014199|Ga0181535_10328781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 907 | Open in IMG/M |
| 3300014491|Ga0182014_10193607 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300014501|Ga0182024_12652338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 537 | Open in IMG/M |
| 3300014657|Ga0181522_10237247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1077 | Open in IMG/M |
| 3300014657|Ga0181522_10918317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 540 | Open in IMG/M |
| 3300014838|Ga0182030_11131434 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300014838|Ga0182030_11371648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 591 | Open in IMG/M |
| 3300015359|Ga0134085_10319562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 685 | Open in IMG/M |
| 3300017925|Ga0187856_1266145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 600 | Open in IMG/M |
| 3300017929|Ga0187849_1370086 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017943|Ga0187819_10649704 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300017955|Ga0187817_10467610 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300018017|Ga0187872_10081156 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300018026|Ga0187857_10144154 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300018034|Ga0187863_10042298 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300018034|Ga0187863_10195404 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300018043|Ga0187887_10570553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300018044|Ga0187890_10689203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300018046|Ga0187851_10559953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300018046|Ga0187851_10664956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 588 | Open in IMG/M |
| 3300018058|Ga0187766_10177186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1336 | Open in IMG/M |
| 3300018062|Ga0187784_10941199 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018088|Ga0187771_11057878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300019268|Ga0181514_1285339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 669 | Open in IMG/M |
| 3300019278|Ga0187800_1135157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 715 | Open in IMG/M |
| 3300019278|Ga0187800_1141951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 867 | Open in IMG/M |
| 3300019278|Ga0187800_1563377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 655 | Open in IMG/M |
| 3300021384|Ga0213876_10520256 | Not Available | 633 | Open in IMG/M |
| 3300021384|Ga0213876_10633200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 569 | Open in IMG/M |
| 3300021560|Ga0126371_11519768 | Not Available | 797 | Open in IMG/M |
| 3300022709|Ga0222756_1081236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 530 | Open in IMG/M |
| 3300022881|Ga0224545_1063575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 521 | Open in IMG/M |
| 3300023090|Ga0224558_1189269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300023552|Ga0247551_105649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 524 | Open in IMG/M |
| 3300025500|Ga0208686_1132712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 510 | Open in IMG/M |
| 3300027825|Ga0209039_10362677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 560 | Open in IMG/M |
| 3300027855|Ga0209693_10558172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 543 | Open in IMG/M |
| 3300027869|Ga0209579_10404646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 740 | Open in IMG/M |
| 3300027889|Ga0209380_10269417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1001 | Open in IMG/M |
| 3300029914|Ga0311359_10619371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 794 | Open in IMG/M |
| 3300029943|Ga0311340_11023857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 677 | Open in IMG/M |
| 3300029951|Ga0311371_11070600 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300029951|Ga0311371_12290451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 559 | Open in IMG/M |
| 3300029955|Ga0311342_10949099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 644 | Open in IMG/M |
| 3300029999|Ga0311339_11418477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 623 | Open in IMG/M |
| 3300030730|Ga0307482_1192689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 616 | Open in IMG/M |
| 3300030741|Ga0265459_14034606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031236|Ga0302324_100069457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6167 | Open in IMG/M |
| 3300031236|Ga0302324_101200623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1011 | Open in IMG/M |
| 3300031238|Ga0265332_10277290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 693 | Open in IMG/M |
| 3300031261|Ga0302140_10070866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3660 | Open in IMG/M |
| 3300031261|Ga0302140_10282456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1420 | Open in IMG/M |
| 3300031474|Ga0170818_103731261 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031524|Ga0302320_11392860 | Not Available | 699 | Open in IMG/M |
| 3300031525|Ga0302326_12206189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300031545|Ga0318541_10873850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 502 | Open in IMG/M |
| 3300031590|Ga0307483_1031648 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031708|Ga0310686_114627667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 580 | Open in IMG/M |
| 3300031956|Ga0316032_107388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 555 | Open in IMG/M |
| 3300032160|Ga0311301_11098141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1035 | Open in IMG/M |
| 3300032515|Ga0348332_10354143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 635 | Open in IMG/M |
| 3300032770|Ga0335085_11982970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300032782|Ga0335082_10703841 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300032783|Ga0335079_10721593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1039 | Open in IMG/M |
| 3300032783|Ga0335079_11607228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300032828|Ga0335080_10803822 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300032892|Ga0335081_12701912 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032893|Ga0335069_12494182 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032897|Ga0335071_10948806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 807 | Open in IMG/M |
| 3300032955|Ga0335076_11748198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 511 | Open in IMG/M |
| 3300033134|Ga0335073_10514309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1363 | Open in IMG/M |
| 3300033158|Ga0335077_11385225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300033402|Ga0326728_10620299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 836 | Open in IMG/M |
| 3300033402|Ga0326728_11007961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 576 | Open in IMG/M |
| 3300033755|Ga0371489_0061301 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300033983|Ga0371488_0194541 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300034195|Ga0370501_0382588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.86% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.90% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003298 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004619 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011045 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0006841J48915_1139922 | 3300003298 | Peatlands Soil | VKFRIHEHVLLRVDFLDYITTFPKRQIMPAPNNTARGIFQQFTPLFGVSYTF* |
| Ga0068953_13575491 | 3300004619 | Peatlands Soil | HMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF* |
| Ga0066388_1044989652 | 3300005332 | Tropical Forest Soil | VRFRLRNNLLLRGEFLDYLTTFPRQQIAPAPHNTARGIFEQFTPLFGASYTF* |
| Ga0070671_1006374421 | 3300005355 | Switchgrass Rhizosphere | RAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVGYLF* |
| Ga0066660_110613871 | 3300006800 | Soil | MLLRAEFLDYLTTFPRQQIVPASHNTARRIFQQFTPLFGVGYTF |
| Ga0105240_109408391 | 3300009093 | Corn Rhizosphere | NLLLRGEFRDHITTFPRQQIVPAPHNTARGIFEQFTPLFGVSYCF* |
| Ga0105248_101731813 | 3300009177 | Switchgrass Rhizosphere | MLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVGYLF* |
| Ga0116117_11202542 | 3300009635 | Peatland | PHMLLRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGISYTFDSLRRH* |
| Ga0116112_10455201 | 3300009636 | Peatland | LLRAEFRDYLTTFPRQQIVPAVHNTARGVFEQFTPLFGVSYTF* |
| Ga0116217_101279334 | 3300009700 | Peatlands Soil | LLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGLSYTFGHLF* |
| Ga0116101_11683772 | 3300009759 | Peatland | GGAKFRLLKQMEMRVEFRDYLTTFPRQQIVPAPHNTARGVFQQFTPLFGVVYVIQSRR* |
| Ga0126373_118402301 | 3300010048 | Tropical Forest Soil | KYRLIPHLLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGASYDFNWR* |
| Ga0126370_100090585 | 3300010358 | Tropical Forest Soil | VRFRLRNHLLLRGEFLDYLTTFPRQQIAPAPHNTARGIFEQFTPVFGASYTF* |
| Ga0126378_119670351 | 3300010361 | Tropical Forest Soil | LLRTQFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF* |
| Ga0126381_1021163572 | 3300010376 | Tropical Forest Soil | FTTFPRTQFVPAPQATARGIFQQLTPLFGVSYTFQ* |
| Ga0136449_1016845931 | 3300010379 | Peatlands Soil | VKFRLIPHMLLRAEFRDYLTTFPRQQIVPAPHNTARGVFEQFTPL |
| Ga0136449_1037052252 | 3300010379 | Peatlands Soil | HMQLRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVAYTF* |
| Ga0138598_1448552 | 3300011045 | Peatlands Soil | RIHEHVLLRVDFLDYITTFPKRQIMPAPNNTARGIFQQFTPLFGVSYTF* |
| Ga0137378_113640621 | 3300012210 | Vadose Zone Soil | MVLRSEFRDYITTFPRQQIVPAPHNTARGISEQFTPLFGVSYTF* |
| Ga0150985_1182250131 | 3300012212 | Avena Fatua Rhizosphere | EFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVGYVF* |
| Ga0137361_112563691 | 3300012362 | Vadose Zone Soil | FRDYLTTFPRRQIVPAANGTARGIFQQFTPFFGVSYTF* |
| Ga0163162_113379192 | 3300013306 | Switchgrass Rhizosphere | MLRAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTQVFGVGYLF* |
| Ga0181524_101893053 | 3300014155 | Bog | YLTTFPKQQIVPAAYSTARGIFQQFTPMAGVSYVF* |
| Ga0181529_100399415 | 3300014161 | Bog | GVKFRPMPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF* |
| Ga0181532_100382451 | 3300014164 | Bog | HMVLRAEFRDYITTFPRQQIVPALHNTARGIFEQFTPLFGVSYTF* |
| Ga0181528_100181395 | 3300014167 | Bog | PLPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF* |
| Ga0181528_102997501 | 3300014167 | Bog | LRAEFRDYLTTFPRQEIVPAVHNTARGIFEQFTPLLGIDYTF* |
| Ga0181535_103287811 | 3300014199 | Bog | RDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF* |
| Ga0182014_101936071 | 3300014491 | Bog | MEMRLEFRDYLTTFPRQQIVPAPNNTARGIFQQFTPLFGVVYVIQSRR* |
| Ga0182024_126523381 | 3300014501 | Permafrost | EFRDYLTTFPRQEIVPAAHNTARGIFEQFTPLFGVAYTFR* |
| Ga0181522_102372471 | 3300014657 | Bog | RPLPHMLVRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLLGIAYTF* |
| Ga0181522_109183172 | 3300014657 | Bog | DYLTTFPRQQIVPAPHNTARGIAEQFTPLFGIAYTF* |
| Ga0182030_111314342 | 3300014838 | Bog | KFRLIPRMLLRAEFRDCITTFPRQQIVPAPHNTARGIFEQFTPLFGISYER* |
| Ga0182030_113716482 | 3300014838 | Bog | MLLRAEFRDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGVSYTF* |
| Ga0134085_103195621 | 3300015359 | Grasslands Soil | SVGGGLKIRPMPHMLLRAEFLDYLTTFPRQQIVPASHNTARGIFQQFTPLFGVSYIF* |
| Ga0187856_12661452 | 3300017925 | Peatland | YLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0187849_13700862 | 3300017929 | Peatland | FDFRDYLTTFPKQQIVPAAYSTARGIFQQFTPMFGVSYLF |
| Ga0187819_106497041 | 3300017943 | Freshwater Sediment | GVEYRLRPHVLLRGEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0187817_104676102 | 3300017955 | Freshwater Sediment | RLDFRDYINTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF |
| Ga0187781_103642201 | 3300017972 | Tropical Peatland | SAGGGISFKPIPHLLLRGEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGASYTFR |
| Ga0187872_100811562 | 3300018017 | Peatland | TTFPRQEIVPAPHNIARGIFEQFTPLFGISYTFQGR |
| Ga0187857_101441541 | 3300018026 | Peatland | DYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF |
| Ga0187863_100422985 | 3300018034 | Peatland | EFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0187863_101954043 | 3300018034 | Peatland | RDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGISYTF |
| Ga0187887_105705531 | 3300018043 | Peatland | FRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYKFARR |
| Ga0187890_106892031 | 3300018044 | Peatland | QMEMRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYIF |
| Ga0187851_105599532 | 3300018046 | Peatland | KYRLTDHVQLRFDFRNYLTTFPKQQIVPAAYSTARGIFQQFTPVVGVSYVF |
| Ga0187851_106649561 | 3300018046 | Peatland | FRPIKQMEMRVEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLFGVVYVIQSRR |
| Ga0187766_101771863 | 3300018058 | Tropical Peatland | RVDFRDYLTAFPHDQIAPAKGNTARGIFQMFTPMVGVSAWF |
| Ga0187784_109411992 | 3300018062 | Tropical Peatland | YRLIDHMQLRVDFRDYLTTFPRTQIVPAPHNTARGVFEQFTPLFGVSYTF |
| Ga0187771_110578783 | 3300018088 | Tropical Peatland | FRDYMTTFNRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0181514_12853392 | 3300019268 | Peatland | GGGAKFRLLKQMEMRVEFRDYLTTFPRQQIVPAPHNTARGVFQQFTPLFGVVYVIQSGR |
| Ga0187800_11351573 | 3300019278 | Peatland | DYLTTFPRQQIVPAPHNTARGIFEQFTPLFGAGYTF |
| Ga0187800_11419511 | 3300019278 | Peatland | GGLRFRPMKQMEMRVEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLFGVVYVIQSRR |
| Ga0187800_15633771 | 3300019278 | Peatland | LLLRAEFRDYVTTFPRQQIVPAPHNTARGIFEQFTPVFGVSYTFGM |
| Ga0213876_105202561 | 3300021384 | Plant Roots | VKYRLQRHVILRADFRDYLTTFPKRQLMPAPHGTARGIFEQFTPFFGVSYVF |
| Ga0213876_106332002 | 3300021384 | Plant Roots | YLTTFPRQQIAPAPHNTARGIFEQFTPLFGLSYVF |
| Ga0126371_115197681 | 3300021560 | Tropical Forest Soil | KVLLRGEFLDYLTTFPRTQIVPAPHNTARGIFEQFTPLFGVSYVF |
| Ga0222756_10812361 | 3300022709 | Soil | LRVDFLDYITTFPRRQIMPAPHGTARGIFQQFTPLFGVSYTF |
| Ga0224545_10635751 | 3300022881 | Soil | FRLLPQMLLRVEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVSYTF |
| Ga0224558_11892691 | 3300023090 | Soil | DYLTTFPKQQIVPAAYSTARGIFQQFTPMLGVSYVF |
| Ga0247551_1056492 | 3300023552 | Soil | GVKFRVQEHVLLRVDFLDYITTFPRRQIMPAPHNTARGMFQQFTPLFGISYTF |
| Ga0208686_11327122 | 3300025500 | Peatland | AEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF |
| Ga0209039_103626772 | 3300027825 | Bog Forest Soil | IQHMLLRAELRDYLTTFPRQQIVPAPHNTARGVFEQFTPLFGVSYTF |
| Ga0209693_105581721 | 3300027855 | Soil | YITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0209579_104046461 | 3300027869 | Surface Soil | IQEHVLLRVDFLDYITTFPRRQIMPAPHDTARGMFQQFTPLFGVSYTF |
| Ga0209380_102694171 | 3300027889 | Soil | LLRGEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0311359_106193711 | 3300029914 | Bog | MPHMLLRAEFRDYLTTFPKAQIVPAPNNTARGIFEQFTPLFGISYTF |
| Ga0311340_110238572 | 3300029943 | Palsa | RDHMLLRGEFLDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGISYTF |
| Ga0311371_110706002 | 3300029951 | Palsa | ILLRGEFLDYLTTFPRQQIVPAPNSTARGIFEQFTPLFGISYTF |
| Ga0311371_122904511 | 3300029951 | Palsa | VKFRPIKQMEMRLEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLLGLVYVIQSRR |
| Ga0311342_109490991 | 3300029955 | Bog | GGVKFRLRSHMLLRAEFRDYLTTFDRQEIVPAPHNTARGIFEQFTPLFGLSYTF |
| Ga0311339_114184772 | 3300029999 | Palsa | GCGVKFRPIKQMEMRLEFRDYLTTFPRQQIVPAPNNTARGVFQQFTPLLGLVYVIQSRR |
| Ga0307482_11926891 | 3300030730 | Hardwood Forest Soil | VQTHILLRLDFRDYITTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF |
| Ga0265459_140346061 | 3300030741 | Soil | KYRIQEHVVLRVDFLDYITTFPRRQILPAPGNTARGLFEQFTPLFGVGYLF |
| Ga0302324_1000694572 | 3300031236 | Palsa | VQFRLIDHMLLRADFRDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGVSYTF |
| Ga0302324_1012006232 | 3300031236 | Palsa | EFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGISYTR |
| Ga0265332_102772901 | 3300031238 | Rhizosphere | RPHLVLRAEMRDYLTTFPRQQIVPAAHNTARGIFEQFTPLFAIGYSF |
| Ga0302140_100708663 | 3300031261 | Bog | MPHMEWRAEFRDYLTTFPRQQIVPAPHNTARGIAEQFTPLFGVAYTFR |
| Ga0302140_102824562 | 3300031261 | Bog | MELRAEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0170818_1037312613 | 3300031474 | Forest Soil | AEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0302320_113928601 | 3300031524 | Bog | MLLRAEFRDYITTFPRQEIVPAPHNTARGIFEQFTPLFGL |
| Ga0302326_122061892 | 3300031525 | Palsa | VEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTF |
| Ga0318541_108738501 | 3300031545 | Soil | GGGLTFLLHPHVLLRTEFRDYLTTFPRQQIVPAPNNTARGIFEQFTLLFGVSYTF |
| Ga0307483_10316481 | 3300031590 | Hardwood Forest Soil | GVKFRIQEHVLLRVDFLDYITTFPRRQIMPAPHGTARGMFQQFTPLFGVSYTF |
| Ga0310686_1146276671 | 3300031708 | Soil | LRAEFRDYLTTFPRTEIVPAPHNTARGIFEQFTPVFGVSYTF |
| Ga0316032_1073881 | 3300031956 | Soil | RIQEHILLRLDFLDYITTFPRQQILPAPHNTARGIFEQFTPLFGVSYSF |
| Ga0311301_110981412 | 3300032160 | Peatlands Soil | HMLLRAEFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGVSYDF |
| Ga0348332_103541432 | 3300032515 | Plant Litter | VLLRLDFRDYITTFPSAEITPAPHNTARGVFEQFTPLFGVSYLF |
| Ga0335085_119829701 | 3300032770 | Soil | SPMPHVLVRAEFLDYITTFPRQQIVPAPHNTARGIFEQFTPLFGISYVF |
| Ga0335082_107038412 | 3300032782 | Soil | EFRDYLTTFPRQQIVPAPHNTARGIFQQYTPLFGLGYTF |
| Ga0335079_107215932 | 3300032783 | Soil | RDYMTAFPKQQIVPAEHSTAHGIFHQYTPLLGLSYTF |
| Ga0335079_116072281 | 3300032783 | Soil | DFRDYLTTFPKKQIVPAIYSTDRGIFQQFTPMLGASYTF |
| Ga0335080_108038221 | 3300032828 | Soil | VTLRVIPHMLVRAELRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTIAR |
| Ga0335081_127019121 | 3300032892 | Soil | LLLRAEFRDYLTTFPRQQIVPAPHNTARGIFQQFTPLFGVRYTF |
| Ga0335069_124941821 | 3300032893 | Soil | LLRPHMLLRAEFRDYLTTFPRQQIVPAEHNTARGVFEQFTPLVGVSYTF |
| Ga0335071_109488062 | 3300032897 | Soil | EYRLIPHMLLRVEFRDYLTTFPRQEIVPAPHNTARGIFEQFTPLFGVSYTFGR |
| Ga0335076_117481981 | 3300032955 | Soil | AGGGIEYRMRPHVLLRGEFRDYLTTFPRQQIVPAPNNTARGIFEQFTPLFGISYTF |
| Ga0335073_105143091 | 3300033134 | Soil | EFRDYLTTFPRQEIVPALHNTARGIFEQFTPLFGVSYTFGR |
| Ga0335077_113852251 | 3300033158 | Soil | RVDFRDYLTTFPRQQIVPAPHNTARGIFEQFTPLFGLVYTF |
| Ga0326728_106202993 | 3300033402 | Peat Soil | PRPHVLLRAEFRDYLTTFPRQQIVPAPHNTARGVFEQFTPLFGVSYTF |
| Ga0326728_110079611 | 3300033402 | Peat Soil | KFRPRPHVLVRAEFRDYLTTFPRTEIVPAPHNTARGVFEQFTPLAGIGYTF |
| Ga0371489_0061301_1_159 | 3300033755 | Peat Soil | VKFRLLPHMLLRAEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF |
| Ga0371488_0194541_2_133 | 3300033983 | Peat Soil | LLRAEFRDYLTTFPRQQIVPALHNTARGVFEQFTPLFGVSYTF |
| Ga0370501_0382588_385_513 | 3300034195 | Untreated Peat Soil | LRVEFRDYLTTFPRSQIVPAPHNTARGVFQQFTPLVGAAYAF |
| ⦗Top⦘ |