| Basic Information | |
|---|---|
| Family ID | F095158 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKQTYIVEFNTTNTQDGWSRIEFTSITKALGFISLMVKRGTHCQIFQG |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 67.62 % |
| % of genes near scaffold ends (potentially truncated) | 20.00 % |
| % of genes from short scaffolds (< 2000 bps) | 65.71 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (56.190 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.11% β-sheet: 23.68% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF14549 | P22_Cro | 10.48 |
| PF04404 | ERF | 7.62 |
| PF01381 | HTH_3 | 6.67 |
| PF07120 | DUF1376 | 3.81 |
| PF00145 | DNA_methylase | 2.86 |
| PF09588 | YqaJ | 2.86 |
| PF13392 | HNH_3 | 1.90 |
| PF05772 | NinB | 1.90 |
| PF01844 | HNH | 1.90 |
| PF04466 | Terminase_3 | 0.95 |
| PF01464 | SLT | 0.95 |
| PF05037 | DUF669 | 0.95 |
| PF13479 | AAA_24 | 0.95 |
| PF12708 | Pectate_lyase_3 | 0.95 |
| PF01507 | PAPS_reduct | 0.95 |
| PF02075 | RuvC | 0.95 |
| PF15943 | YdaS_antitoxin | 0.95 |
| PF02592 | Vut_1 | 0.95 |
| PF04860 | Phage_portal | 0.95 |
| PF16510 | P22_portal | 0.95 |
| PF10926 | DUF2800 | 0.95 |
| PF13730 | HTH_36 | 0.95 |
| PF01555 | N6_N4_Mtase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 3.81 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.86 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.95 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.95 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.95 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.05 % |
| Unclassified | root | N/A | 20.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10102055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300002470|metazooDRAFT_1360920 | Not Available | 713 | Open in IMG/M |
| 3300002844|contig_10324 | Not Available | 872 | Open in IMG/M |
| 3300003277|JGI25908J49247_10006388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3751 | Open in IMG/M |
| 3300003277|JGI25908J49247_10021974 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300003277|JGI25908J49247_10133724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300003277|JGI25908J49247_10171210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300003375|JGI26470J50227_1003409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4827 | Open in IMG/M |
| 3300003393|JGI25909J50240_1022896 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300003393|JGI25909J50240_1094034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300004240|Ga0007787_10060267 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
| 3300005580|Ga0049083_10066828 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300005580|Ga0049083_10295132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300005581|Ga0049081_10032215 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300005581|Ga0049081_10044200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage Va1 | 1689 | Open in IMG/M |
| 3300005581|Ga0049081_10168531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300005582|Ga0049080_10039673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1636 | Open in IMG/M |
| 3300005584|Ga0049082_10062309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
| 3300005584|Ga0049082_10202792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300005585|Ga0049084_10118193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 942 | Open in IMG/M |
| 3300005940|Ga0073913_10021805 | Not Available | 928 | Open in IMG/M |
| 3300006802|Ga0070749_10418327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 738 | Open in IMG/M |
| 3300006802|Ga0070749_10748828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 520 | Open in IMG/M |
| 3300008459|Ga0114865_1034087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2141 | Open in IMG/M |
| 3300009082|Ga0105099_10678592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300009151|Ga0114962_10021247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4581 | Open in IMG/M |
| 3300009151|Ga0114962_10367754 | Not Available | 785 | Open in IMG/M |
| 3300009151|Ga0114962_10380806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300009154|Ga0114963_10439326 | Not Available | 702 | Open in IMG/M |
| 3300009155|Ga0114968_10011407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6362 | Open in IMG/M |
| 3300009155|Ga0114968_10023882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4173 | Open in IMG/M |
| 3300009155|Ga0114968_10209118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300009161|Ga0114966_10306033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300009163|Ga0114970_10027732 | All Organisms → Viruses → Predicted Viral | 3788 | Open in IMG/M |
| 3300009164|Ga0114975_10000273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 38787 | Open in IMG/M |
| 3300009164|Ga0114975_10020993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3962 | Open in IMG/M |
| 3300009180|Ga0114979_10148283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1436 | Open in IMG/M |
| 3300009187|Ga0114972_10159806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
| 3300009684|Ga0114958_10005037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9005 | Open in IMG/M |
| 3300010158|Ga0114960_10621489 | Not Available | 510 | Open in IMG/M |
| 3300010160|Ga0114967_10209766 | Not Available | 1042 | Open in IMG/M |
| 3300010160|Ga0114967_10419210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300010334|Ga0136644_10798587 | Not Available | 508 | Open in IMG/M |
| 3300011334|Ga0153697_1060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34874 | Open in IMG/M |
| 3300011334|Ga0153697_1529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11169 | Open in IMG/M |
| 3300012012|Ga0153799_1001590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6518 | Open in IMG/M |
| 3300013372|Ga0177922_11346405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300017716|Ga0181350_1046460 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
| 3300017723|Ga0181362_1108193 | Not Available | 549 | Open in IMG/M |
| 3300017754|Ga0181344_1147700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300017777|Ga0181357_1123760 | Not Available | 968 | Open in IMG/M |
| 3300017778|Ga0181349_1020110 | All Organisms → Viruses → Predicted Viral | 2731 | Open in IMG/M |
| 3300017778|Ga0181349_1260368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300017785|Ga0181355_1152833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300019784|Ga0181359_1006660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3874 | Open in IMG/M |
| 3300019784|Ga0181359_1100725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
| 3300019784|Ga0181359_1151095 | Not Available | 796 | Open in IMG/M |
| 3300020048|Ga0207193_1257976 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300021952|Ga0213921_1003875 | All Organisms → Viruses → Predicted Viral | 3195 | Open in IMG/M |
| 3300021961|Ga0222714_10454027 | Not Available | 666 | Open in IMG/M |
| 3300021962|Ga0222713_10579893 | Not Available | 658 | Open in IMG/M |
| 3300021963|Ga0222712_10142925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
| 3300022179|Ga0181353_1005979 | All Organisms → Viruses → Predicted Viral | 2903 | Open in IMG/M |
| 3300022190|Ga0181354_1017913 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
| 3300022190|Ga0181354_1180590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300023179|Ga0214923_10001649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31329 | Open in IMG/M |
| 3300025896|Ga0208916_10020529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2611 | Open in IMG/M |
| 3300027393|Ga0209867_1053626 | Not Available | 605 | Open in IMG/M |
| 3300027608|Ga0208974_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 63044 | Open in IMG/M |
| 3300027608|Ga0208974_1014287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2528 | Open in IMG/M |
| 3300027608|Ga0208974_1156907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kunmingvirus → Kunmingvirus kv4D05 | 574 | Open in IMG/M |
| 3300027621|Ga0208951_1050796 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300027708|Ga0209188_1040819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2130 | Open in IMG/M |
| 3300027712|Ga0209499_1016683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3511 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1139846 | Not Available | 1069 | Open in IMG/M |
| 3300027732|Ga0209442_1267781 | Not Available | 603 | Open in IMG/M |
| 3300027736|Ga0209190_1000527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27898 | Open in IMG/M |
| 3300027741|Ga0209085_1001847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12575 | Open in IMG/M |
| 3300027749|Ga0209084_1020756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3561 | Open in IMG/M |
| 3300027754|Ga0209596_1193280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300027759|Ga0209296_1000542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32862 | Open in IMG/M |
| 3300027759|Ga0209296_1354948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300027763|Ga0209088_10196854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300027764|Ga0209134_10339136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300027770|Ga0209086_10004978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9746 | Open in IMG/M |
| 3300027785|Ga0209246_10286332 | Not Available | 634 | Open in IMG/M |
| 3300027808|Ga0209354_10261594 | Not Available | 693 | Open in IMG/M |
| 3300027808|Ga0209354_10285887 | Not Available | 658 | Open in IMG/M |
| 3300027969|Ga0209191_1000304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 38787 | Open in IMG/M |
| 3300028025|Ga0247723_1003892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7266 | Open in IMG/M |
| 3300028025|Ga0247723_1028827 | All Organisms → Viruses → Predicted Viral | 1774 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1063267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1268252 | Not Available | 545 | Open in IMG/M |
| 3300028394|Ga0304730_1000558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 31761 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1009457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9332 | Open in IMG/M |
| 3300031999|Ga0315274_10234853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2242 | Open in IMG/M |
| 3300031999|Ga0315274_11478047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300031999|Ga0315274_11492509 | Not Available | 643 | Open in IMG/M |
| 3300032053|Ga0315284_11068486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300032164|Ga0315283_11692069 | Not Available | 641 | Open in IMG/M |
| 3300032177|Ga0315276_11774771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 635 | Open in IMG/M |
| 3300034062|Ga0334995_0042104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3809 | Open in IMG/M |
| 3300034106|Ga0335036_0025894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4655 | Open in IMG/M |
| 3300034112|Ga0335066_0106317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1766 | Open in IMG/M |
| 3300034119|Ga0335054_0533100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 28.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.81% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 12.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.57% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.90% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.90% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.95% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.95% |
| Stormwater Retention Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002470 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013 | Environmental | Open in IMG/M |
| 3300002844 | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Jamestown High School | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_101020553 | 3300000882 | Freshwater And Marine | MKQNYIVEFNVEGMQDSWGRMEFTSITKALGFVSLMVKKGAHCQIFQS* |
| metazooDRAFT_13609202 | 3300002470 | Lake | MKQTYIVEFNATGNQNDWAHMEFTSITKALGFISLMVKRGCHCQIFPAFHQGGK* |
| contig_103242 | 3300002844 | Stormwater Retention Pond | MKQTYIVEFNTTNTSDGWSRMEFTSITKALGFISLMVKRGCHCQIFSA* |
| JGI25908J49247_100063887 | 3300003277 | Freshwater Lake | MKQNFIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQIFKS* |
| JGI25908J49247_100219745 | 3300003277 | Freshwater Lake | MKQSYIVEFNAKNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS* |
| JGI25908J49247_101337242 | 3300003277 | Freshwater Lake | MKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK* |
| JGI25908J49247_101712101 | 3300003277 | Freshwater Lake | NLKMANMKPTYIVKFNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK* |
| JGI26470J50227_100340910 | 3300003375 | Freshwater | MKQSYVVEFNTTNSSGDWSRIEFTSITKALGFVSLMVKRGCHCMIFKA* |
| JGI25909J50240_10228961 | 3300003393 | Freshwater Lake | MYDWQLSATKQESKMKQSYIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS* |
| JGI25909J50240_10940343 | 3300003393 | Freshwater Lake | MANMKPTYIVKFNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK* |
| Ga0007787_100602674 | 3300004240 | Freshwater Lake | MKPTYIVKYNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK* |
| Ga0049083_100668281 | 3300005580 | Freshwater Lentic | MANMKPTYIVKYNTLSDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK* |
| Ga0049083_102951323 | 3300005580 | Freshwater Lentic | MANMKPTYIVKYNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFMK* |
| Ga0049081_100322154 | 3300005581 | Freshwater Lentic | MKNFYVVEFNTTNTQDGWSRMEFTSITKALGFVSLMVKRGCHCQIFQGVTA* |
| Ga0049081_100442004 | 3300005581 | Freshwater Lentic | MKNFYVVEINITNTQDGWSRMEFTSITKALSFISLMVKRGHHCQIFQGVTA* |
| Ga0049081_101685312 | 3300005581 | Freshwater Lentic | MANMKPTYIVKYNTLNDQETWSRIEFTSITKALGFISLFVKRGSICKIFMK* |
| Ga0049080_100396733 | 3300005582 | Freshwater Lentic | MKPTYIVKFNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK* |
| Ga0049082_100623093 | 3300005584 | Freshwater Lentic | MKPTYIVKFNTLNDQDTWSRVEFTSITKALGFVSLFVKRGSICKIFQK* |
| Ga0049082_102027922 | 3300005584 | Freshwater Lentic | MANMKPTYIVKFNTLNDQDTWSRVEFTSITKALGFVSLFVKRGSICKIFMK* |
| Ga0049084_101181931 | 3300005585 | Freshwater Lentic | MKQTYIVEFNPTHTQGDWSRIEFTSITKALGFISLMVKRGCHCQIFQS* |
| Ga0073913_100218054 | 3300005940 | Sand | MKPTYIVKFNTLNDQDTWSRVEFTSITKALGFVSLFVKRGSICKIFMK* |
| Ga0070749_104183272 | 3300006802 | Aqueous | MKQTYIVEFSTTGIQGDWSRIEFTSITKALGFISLMVKRGTHCQIFQG* |
| Ga0070749_107488282 | 3300006802 | Aqueous | MKQIYIVEFNTNNEQNNWSHIEFTSLTKALGFVSLMVKRGCHCQIFKG* |
| Ga0114865_10340876 | 3300008459 | Freshwater Lake | MKKTYIIEFNRTHQANDWSRIEFTSLTKALGFISLMVKQGCHCQIFKG* |
| Ga0105099_106785923 | 3300009082 | Freshwater Sediment | MKQTYIVEFNASGTQDGWSRMEFTSISKALGFISVMVKRGCHCQVFQGAA |
| Ga0114962_100212479 | 3300009151 | Freshwater Lake | MKQNYIVEFNTANMQDGWSRMEFTSITKALGFITLMVKQGCHCQIFKS* |
| Ga0114962_103677543 | 3300009151 | Freshwater Lake | MKNFYVVEFNTTNTQDGWSRMEFTSITKALGFISLMVKRGCHCQIFQGVTA* |
| Ga0114962_103808062 | 3300009151 | Freshwater Lake | MKQTYVVEFNQTNTSEGWSRIEFTSITKALGFLSLMVKRGCHCQIFQG* |
| Ga0114963_104393261 | 3300009154 | Freshwater Lake | MPTAHRIGSFGDSMKNFYVVEFNTTNTQDGWSRMEFTSITKALGFVSLMVKRGCHCQIFQGVTA* |
| Ga0114968_1001140714 | 3300009155 | Freshwater Lake | MMQSIPNAIPQGVFLGNIMKQTYIVEFHSTDTESGWSRMEFTSLSKALGFVSVMVKRGCHCQIFQS* |
| Ga0114968_100238824 | 3300009155 | Freshwater Lake | MKQTYVVEFNTTQTSENWSRIEFTSITKALGFLSLMVKRGCHCQIFPTVNHEK* |
| Ga0114968_102091181 | 3300009155 | Freshwater Lake | TYRSGLLGASRMKQSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFKA* |
| Ga0114966_103060332 | 3300009161 | Freshwater Lake | MMKPTYVVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFQK* |
| Ga0114970_100277325 | 3300009163 | Freshwater Lake | MMKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK* |
| Ga0114975_1000027317 | 3300009164 | Freshwater Lake | MKQTYIVEFNTTNTQDGWSRIEFTSITKALGFISLMVKRGTHCQIFQG* |
| Ga0114975_100209933 | 3300009164 | Freshwater Lake | MKQIYIVEFNRTHTQNNWSRMEFTSITKALGFVSLMVKQGCHCQMFKG* |
| Ga0114979_101482831 | 3300009180 | Freshwater Lake | MAKKESKMKQNYIVEFNMTGTQGNWSRMEFTSITKALGFVSLMVKNGAHCQIFQS* |
| Ga0114972_101598062 | 3300009187 | Freshwater Lake | MKNFYVVEFNTTNTQNGRSRMEFTSITKALGFVSLMVKRGCHCQIFQGVTA* |
| Ga0114958_1000503713 | 3300009684 | Freshwater Lake | MKQNYIVEFNATNMQDGWSRMEFTSITKALGFISLMIKQGCHCQIFKS* |
| Ga0114960_106214891 | 3300010158 | Freshwater Lake | QSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFKA* |
| Ga0114967_102097662 | 3300010160 | Freshwater Lake | MKQSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFKA* |
| Ga0114967_104192102 | 3300010160 | Freshwater Lake | MKNFYVVEFNTTNTQDGWSRMEFTSITKTLGFVSLMVKRGCHCQIFQGVTA* |
| Ga0136644_107985872 | 3300010334 | Freshwater Lake | MKTFYVVAFNTTNTQDGWSRMEFTSITKALGFVSLMVKRGCHCQIFQGVTA* |
| Ga0153697_106034 | 3300011334 | Freshwater | MKQIYIVEFNPTHTQGDWSRMEFTSITKALGFISLMVKQGCHCQIFQGVTA* |
| Ga0153697_152912 | 3300011334 | Freshwater | MKRTYVVEFSPTNLQSDWKREEFTSLTKALGFISLMVKQGCHCQILPS* |
| Ga0153799_10015906 | 3300012012 | Freshwater | MKQTYIVEFNPTHTQGDWSRMEFTSITKALGFISLMVKRGCHCQIFQGVTA* |
| Ga0177922_113464051 | 3300013372 | Freshwater | FNRTHQANDWSRIEFTSLTKALGFISLMVKQGCHCQIFKG* |
| Ga0181350_10464601 | 3300017716 | Freshwater Lake | LKMANMKPTYIVKYNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0181362_11081931 | 3300017723 | Freshwater Lake | AQKESKMKKNYIVEFNVTGTQGSWSRMEFTSITKALGFVSLMVKNGAHCQIFQS |
| Ga0181344_11477001 | 3300017754 | Freshwater Lake | MMKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0181357_11237602 | 3300017777 | Freshwater Lake | MAQKESKMKKNYIVEFNVTGTQGSWSRMEFTSITKALGFVSLMVKNGAHCQIFQS |
| Ga0181349_10201101 | 3300017778 | Freshwater Lake | MKQNFIVEFNATNTQDGWSRMEFTSMTKALGFISLM |
| Ga0181349_12603681 | 3300017778 | Freshwater Lake | TMMKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0181355_11528334 | 3300017785 | Freshwater Lake | TRQMAQKESKMKKNYIVEFNVTGTQGSWSRMEFTSITKALGFVSLMVKNGAHCQIFQS |
| Ga0181359_10066607 | 3300019784 | Freshwater Lake | MKQNFIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQIFKS |
| Ga0181359_11007254 | 3300019784 | Freshwater Lake | MANMKPTYIVKFNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK |
| Ga0181359_11510951 | 3300019784 | Freshwater Lake | MKQSYIVEFNAKNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS |
| Ga0207193_12579761 | 3300020048 | Freshwater Lake Sediment | MKQTYIVEFNASGTQDGWSRMEFTSISKALGFISVMVKRGCHCQVFQGATA |
| Ga0213921_10038753 | 3300021952 | Freshwater | MKNFYVVEFNTTNTQDGWSRMEFTSISKALGFVSLMVKRGCHCQIFQGVTA |
| Ga0222714_104540272 | 3300021961 | Estuarine Water | MKRSYVVEFNTTNTTDGWSRIEFTSITKALGFVSLMVKRGVHCQIFQA |
| Ga0222713_105798932 | 3300021962 | Estuarine Water | MKHSYVVKFETDQGESEIEFTSITKALGFISLMVKRGCACKILQK |
| Ga0222712_101429252 | 3300021963 | Estuarine Water | MPQTSWGLIGENMKQIYIVEFNTTNEQNNWSHIEFTSLTKALGFVSLMVKRGCHCQIFKG |
| Ga0181353_100597910 | 3300022179 | Freshwater Lake | MKPTYIVKYNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK |
| Ga0181354_10179131 | 3300022190 | Freshwater Lake | MANMKPTYIVKYNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0181354_11805904 | 3300022190 | Freshwater Lake | TGATAPSFKPSRTIMKPTYIVKFNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFQK |
| Ga0214923_1000164952 | 3300023179 | Freshwater | MKQSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKKGCHCQIFKA |
| Ga0208916_100205295 | 3300025896 | Aqueous | MKQNYIVEFNVEGMQDSWGRMEFTSITKALGFVSLMVKRGAHCQIFQS |
| Ga0209867_10536261 | 3300027393 | Sand | MYDRQLSATKQESKMKQSYIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS |
| Ga0208974_10000305 | 3300027608 | Freshwater Lentic | MKNFYVVEINITNTQDGWSRMEFTSITKALSFISLMVKRGHHCQIFQGVTA |
| Ga0208974_10142877 | 3300027608 | Freshwater Lentic | MKPTYIVKFNTLNDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFQK |
| Ga0208974_11569072 | 3300027608 | Freshwater Lentic | MKQTYIVEFNPTHTQGDWSRMEFTSITKALGFISLMVKRG |
| Ga0208951_10507965 | 3300027621 | Freshwater Lentic | MANMKPTYIVKYNTLSDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0209188_10408193 | 3300027708 | Freshwater Lake | MKQTYVVEFNQTNTSEGWSRIEFTSITKALGFLSLMVKRGCHCQIFQG |
| Ga0209499_10166837 | 3300027712 | Freshwater Lake | MKQNYIVEFNATNMQDGWSRMEFTSITKALGFISLMIKQGCHCQIFKS |
| (restricted) Ga0247836_11398461 | 3300027728 | Freshwater | MKQAYIVEFNATGLQNDWSRMEFTSITKALGFISLMVKRGVHCQIFQS |
| Ga0209442_12677812 | 3300027732 | Freshwater Lake | MYDWQLSATKQESKMKQSYIVEFNAKNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS |
| Ga0209190_100052716 | 3300027736 | Freshwater Lake | MKQSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFKA |
| Ga0209085_10018474 | 3300027741 | Freshwater Lake | MKQTYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFKA |
| Ga0209084_10207563 | 3300027749 | Freshwater Lake | MKQNYIVEFNTANMQDGWSRMEFTSITKALGFITLMVKQGCHCQIFKS |
| Ga0209596_11932801 | 3300027754 | Freshwater Lake | MMQSIPNAIPQGVFLGNIMKQTYIVEFHSTDTESGWSRMEFTSLSKALGFVSVMVKRGCHCQIFQS |
| Ga0209296_100054248 | 3300027759 | Freshwater Lake | MKQIYIVEFNRTHTQNNWSRMEFTSITKALGFVSLMVKQGCHCQMFKG |
| Ga0209296_13549483 | 3300027759 | Freshwater Lake | IVEFNMTGTQGNWSRMEFTSITKALGFVSLMVKNGAHCQIFQS |
| Ga0209088_101968544 | 3300027763 | Freshwater Lake | SATYRSGLLGASRMKQSYVVEWNPTHTADGWSRMEFTSITKALGFISLMAKRGCHCQIFK |
| Ga0209134_103391362 | 3300027764 | Freshwater Lake | MKKTYIIEFNKTHQANDWSRIEFTSLTKALGFISLMVKQGCHCQIFKG |
| Ga0209086_1000497818 | 3300027770 | Freshwater Lake | MKQTYIVEFHSTDTESGWSRMEFTSLSKALGFVSVMVKRGCHCQIFQS |
| Ga0209246_102863321 | 3300027785 | Freshwater Lake | MKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSIC |
| Ga0209354_102615942 | 3300027808 | Freshwater Lake | MYDWQLSATKQESKMKQSYIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQFFKS |
| Ga0209354_102858871 | 3300027808 | Freshwater Lake | RRNKMKQNFIVEFNATNTQDGWSRMEFTSMTKALGFISLMVKSGCHCQIFKS |
| Ga0209191_100030443 | 3300027969 | Freshwater Lake | MKQTYIVEFNTTNTQDGWSRIEFTSITKALGFISLMVKRGTHCQIFQG |
| Ga0247723_100389215 | 3300028025 | Deep Subsurface Sediment | MKHTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0247723_10288273 | 3300028025 | Deep Subsurface Sediment | MANMKPTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFQK |
| (restricted) Ga0247835_10632671 | 3300028114 | Freshwater | MKQAYIVEFNATGLQNDWSRMEFTSITKALGFISLMVKRGVHCQI |
| (restricted) Ga0247835_12682522 | 3300028114 | Freshwater | VFLGVSKMKQTYIVEFNATGLQNDWSRMEFTSITKALGFISLMVKRGVHCQIFQS |
| Ga0304730_10005585 | 3300028394 | Freshwater Lake | MKQTYVVEFNTTQTSENWSRIEFTSITKALGFLSLMVKRGCHCQIFPTVNHEK |
| (restricted) Ga0247832_10094571 | 3300028557 | Freshwater | MKQTYIVEFNATGLQNDWSRMEFTSITKALGFISLMVKRGVHCQIFQS |
| Ga0315274_102348533 | 3300031999 | Sediment | MKPTYIVKFNTLNDQDTWSRVEFTSITKALGFVSLFVKRGSICKIFKI |
| Ga0315274_114780471 | 3300031999 | Sediment | PTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0315274_114925091 | 3300031999 | Sediment | MKFTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICK |
| Ga0315284_110684863 | 3300032053 | Sediment | MKFTYIVKYNTLNDQETWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0315283_116920691 | 3300032164 | Sediment | MANMKPTYIVKYNTLSDQDTWSRIEFTSISKALGFVSLFVKRGSICKIFMK |
| Ga0315276_117747711 | 3300032177 | Sediment | MMKQTYIVEFNATHTQGNWSRMEFTSITKALGFVSLMVKRGCHCQIFQS |
| Ga0334995_0042104_2121_2276 | 3300034062 | Freshwater | MKQTYIVEFNPTHTQGDWSRIEFTSITKALGFISLMVKRGCHCQIMPGVTA |
| Ga0335036_0025894_3740_3922 | 3300034106 | Freshwater | MTHRQMQLKGNKMKRTYVVEFSPTNLQSDWARKEFTSLTKAMAFISLMVKQGCHCQILPS |
| Ga0335066_0106317_2_115 | 3300034112 | Freshwater | MKQTYIVEFNPTHTQGDWSRIEFTSITKALGFISLMVK |
| Ga0335054_0533100_203_349 | 3300034119 | Freshwater | MKQTYIVEFKTDDGWSRIEFTSITKALGFLSLMVKRGCHCQVFQGVTA |
| ⦗Top⦘ |