| Basic Information | |
|---|---|
| Family ID | F095086 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 47 residues |
| Representative Sequence | IRIHAIDIVQPPGIGISPIADMDAHQTIVTAALAAKSSAETPKTA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.69 % |
| % of genes near scaffold ends (potentially truncated) | 91.43 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.952 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 0.00% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF05988 | DUF899 | 69.52 |
| PF09948 | DUF2182 | 12.38 |
| PF13360 | PQQ_2 | 1.90 |
| PF12840 | HTH_20 | 1.90 |
| PF00106 | adh_short | 0.95 |
| PF01207 | Dus | 0.95 |
| PF00970 | FAD_binding_6 | 0.95 |
| PF00359 | PTS_EIIA_2 | 0.95 |
| PF08327 | AHSA1 | 0.95 |
| PF00890 | FAD_binding_2 | 0.95 |
| PF00440 | TetR_N | 0.95 |
| PF01872 | RibD_C | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 69.52 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.95 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.86 % |
| Unclassified | root | N/A | 17.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105733139 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300001661|JGI12053J15887_10426382 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300004092|Ga0062389_104228973 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300004480|Ga0062592_101654819 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300004643|Ga0062591_102508544 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005093|Ga0062594_100242589 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300005332|Ga0066388_102554640 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005438|Ga0070701_10073648 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300005455|Ga0070663_102079648 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005466|Ga0070685_10951500 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005466|Ga0070685_11146659 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005535|Ga0070684_102236744 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005544|Ga0070686_100241220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1316 | Open in IMG/M |
| 3300005549|Ga0070704_100252821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1448 | Open in IMG/M |
| 3300005564|Ga0070664_100363720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1318 | Open in IMG/M |
| 3300005602|Ga0070762_11223141 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005718|Ga0068866_11354112 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005764|Ga0066903_100378642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
| 3300005764|Ga0066903_104590900 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005829|Ga0074479_10595870 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006034|Ga0066656_10712623 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006845|Ga0075421_101581866 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006904|Ga0075424_100169317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2317 | Open in IMG/M |
| 3300007255|Ga0099791_10042329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2024 | Open in IMG/M |
| 3300007265|Ga0099794_10512493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300009094|Ga0111539_11060518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300009148|Ga0105243_10342944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1369 | Open in IMG/M |
| 3300009157|Ga0105092_10216770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300009444|Ga0114945_10763814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 592 | Open in IMG/M |
| 3300009551|Ga0105238_10408224 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300009792|Ga0126374_10908544 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010046|Ga0126384_10537615 | Not Available | 1013 | Open in IMG/M |
| 3300010159|Ga0099796_10082702 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300010339|Ga0074046_10456551 | Not Available | 766 | Open in IMG/M |
| 3300010358|Ga0126370_11821053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Cellvibrio → unclassified Cellvibrio → Cellvibrio sp. PSBB006 | 590 | Open in IMG/M |
| 3300010359|Ga0126376_12125017 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010359|Ga0126376_12386813 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010360|Ga0126372_12366269 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010362|Ga0126377_10292373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1603 | Open in IMG/M |
| 3300010362|Ga0126377_11795403 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010373|Ga0134128_10100665 | All Organisms → cellular organisms → Bacteria | 3286 | Open in IMG/M |
| 3300010375|Ga0105239_10684423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300010397|Ga0134124_10234828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
| 3300010397|Ga0134124_11696652 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010399|Ga0134127_10735530 | Not Available | 1030 | Open in IMG/M |
| 3300010400|Ga0134122_10199925 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300010400|Ga0134122_10916526 | Not Available | 850 | Open in IMG/M |
| 3300010403|Ga0134123_10241486 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300010863|Ga0124850_1118149 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010868|Ga0124844_1200008 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300010868|Ga0124844_1200009 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300011270|Ga0137391_11574628 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012203|Ga0137399_11610507 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012351|Ga0137386_10897577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 635 | Open in IMG/M |
| 3300012355|Ga0137369_10794596 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012922|Ga0137394_11550779 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012924|Ga0137413_11472399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 552 | Open in IMG/M |
| 3300012948|Ga0126375_12067250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 505 | Open in IMG/M |
| 3300013308|Ga0157375_11563900 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300014501|Ga0182024_10916246 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300014867|Ga0180076_1033759 | Not Available | 880 | Open in IMG/M |
| 3300014968|Ga0157379_10851063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 863 | Open in IMG/M |
| 3300015241|Ga0137418_10678050 | Not Available | 795 | Open in IMG/M |
| 3300015371|Ga0132258_13218145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1126 | Open in IMG/M |
| 3300016294|Ga0182041_10969996 | Not Available | 767 | Open in IMG/M |
| 3300018056|Ga0184623_10016061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3285 | Open in IMG/M |
| 3300018422|Ga0190265_10972558 | Not Available | 971 | Open in IMG/M |
| 3300021180|Ga0210396_10648356 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300021401|Ga0210393_11263673 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021444|Ga0213878_10025710 | Not Available | 2198 | Open in IMG/M |
| 3300021444|Ga0213878_10186592 | Not Available | 869 | Open in IMG/M |
| 3300024181|Ga0247693_1022799 | Not Available | 841 | Open in IMG/M |
| 3300025916|Ga0207663_11702714 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025925|Ga0207650_10230755 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300025925|Ga0207650_10818926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 789 | Open in IMG/M |
| 3300025935|Ga0207709_11784066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → Undibacterium flavidum | 512 | Open in IMG/M |
| 3300025938|Ga0207704_11609781 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300025938|Ga0207704_11944933 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025941|Ga0207711_10144298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2144 | Open in IMG/M |
| 3300025941|Ga0207711_10312501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300025944|Ga0207661_10686144 | Not Available | 942 | Open in IMG/M |
| 3300026023|Ga0207677_11533235 | Not Available | 616 | Open in IMG/M |
| 3300026067|Ga0207678_10031065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4661 | Open in IMG/M |
| 3300026555|Ga0179593_1130860 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
| 3300027171|Ga0207947_1008211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 702 | Open in IMG/M |
| 3300027545|Ga0209008_1123922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300027743|Ga0209593_10115836 | Not Available | 978 | Open in IMG/M |
| 3300027862|Ga0209701_10346058 | Not Available | 842 | Open in IMG/M |
| 3300027887|Ga0208980_10109246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1622 | Open in IMG/M |
| 3300027890|Ga0209496_10681435 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027894|Ga0209068_10959091 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300027909|Ga0209382_11302370 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300030006|Ga0299907_10783007 | Not Available | 721 | Open in IMG/M |
| 3300031229|Ga0299913_10191696 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300031538|Ga0310888_10034659 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300031548|Ga0307408_100498973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300031793|Ga0318548_10401473 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031823|Ga0307478_10571128 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300032025|Ga0318507_10347354 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032075|Ga0310890_10126541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1652 | Open in IMG/M |
| 3300032261|Ga0306920_103708096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 560 | Open in IMG/M |
| 3300033290|Ga0318519_10973286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 526 | Open in IMG/M |
| 3300033407|Ga0214472_11060973 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300034176|Ga0364931_0158442 | Not Available | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.95% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1057331392 | 3300000955 | Soil | HVCPGIRIHAIDIVQPPGIGISPIADMDAHQTLVTTALAAKSSAETPRNAC* |
| JGI12053J15887_104263821 | 3300001661 | Forest Soil | GIRIHAIDIVQPPGIGISPIADMDAHQTMVTAALAAKSSAEMPKNAC* |
| Ga0062389_1042289732 | 3300004092 | Bog Forest Soil | HAIDIVQPPGIAIPPIADMDAQDAIVTAALTAKSSAEAPKNACWET* |
| Ga0062592_1016548192 | 3300004480 | Soil | IHAIDIVQPPGIGIPPIADIEAHQAIVAAALTTKSSAETPRNA* |
| Ga0062591_1025085441 | 3300004643 | Soil | GIRIHVIDIVQPPGIGISPIADMEEHQANVTAALAAKRRVETPKKAC* |
| Ga0062594_1002425893 | 3300005093 | Soil | HAIDIVQPPGIVIPPMADMVPHQTIVAVALAAKTSVETA* |
| Ga0066388_1025546403 | 3300005332 | Tropical Forest Soil | VRSETTPPRIHAIDIVQPPGIGISPIADMEGHQTIVTAALAAKSSAE |
| Ga0070701_100736484 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GIRIHAIDIVQPPGIVIPPMADMVPHQTIVAVALAAKTSVETA* |
| Ga0070663_1020796481 | 3300005455 | Corn Rhizosphere | IRIHAIDIVQPPGIGIPPIADIEAHQAIVAAALTAKSSAETPRNA* |
| Ga0070685_109515001 | 3300005466 | Switchgrass Rhizosphere | RIHAIDIVQPPGIGIPPIADIEAHQAIVAAALTTKSSAETPRNA* |
| Ga0070685_111466591 | 3300005466 | Switchgrass Rhizosphere | SGIRIHAIDIVQPPGIVIPPMADMVPHQTIVAVALAAKTSVETA* |
| Ga0070684_1022367442 | 3300005535 | Corn Rhizosphere | IRIHAIDIVQPPGIGIPPIADIDVHQTIVTAALTAKSSAATPKNA* |
| Ga0070686_1002412201 | 3300005544 | Switchgrass Rhizosphere | WPGIRIHAIDIDHPPGIGISPIPDIDPHHTIVTAALEATSSPDTPRNAAWGHRS* |
| Ga0070704_1002528213 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | HAIDIDHPPGIGISPIPDIDPHHTIVTAALEATSSPDTPRNAAWGHRS* |
| Ga0070664_1003637203 | 3300005564 | Corn Rhizosphere | GHVCPGIRIHAIDIVQPPGIGIPPIADIEAHQAIVAAALTAKSSAETPRNA* |
| Ga0070762_112231411 | 3300005602 | Soil | VCPGIRIHAIDRVQPPGIGISLIADMDAHAWIVTAVPATKSSAEMPKKAR* |
| Ga0068866_113541121 | 3300005718 | Miscanthus Rhizosphere | VCPGIRIHAIDIVQPPAIGISSMPDMDAHQMIVTATLATKSSAETPRNAC* |
| Ga0066903_1003786421 | 3300005764 | Tropical Forest Soil | GIRIHAIDIVHPPGIGISPIVDMDAHQTIVTAALTAKSSADTPQKAR* |
| Ga0066903_1045909002 | 3300005764 | Tropical Forest Soil | PGIRIHAIDIVQPPGIGIPPIAGMDTHQTIVTAALAAKSSTETPKNARLETSSETMN* |
| Ga0074479_105958701 | 3300005829 | Sediment (Intertidal) | PHIRIHAIDIVQPPGIGISPIADMDAHQTIVTATLAAKSSAETP* |
| Ga0066656_107126232 | 3300006034 | Soil | VAARAQGASQPPGIGISPIADMDANQTIVTAVLAAKSGAETPRNACWEAR* |
| Ga0075421_1015818661 | 3300006845 | Populus Rhizosphere | GIRIHTIDIVQPPGIGIPIADMDAHQTIVSVVLTAKSNAKTPRNPAPED* |
| Ga0075424_1001693173 | 3300006904 | Populus Rhizosphere | GIRIHAIDIVQPPGIGISPIADMDVLQTIVIAAQAAKSSAEIPRNAW* |
| Ga0099791_100423293 | 3300007255 | Vadose Zone Soil | MRIHAIDIVQPPGIGISPIPDMDAHQTIVTAALAAKSSAETPKKARWE |
| Ga0099794_105124931 | 3300007265 | Vadose Zone Soil | MRIIHAIDIVQPPGIGISPIADMDVHQTIVPAALAVKRSPETPKKARWEAR |
| Ga0111539_110605181 | 3300009094 | Populus Rhizosphere | MRIHAIDIVQPPGIAISLIADMAEHHTIVTVALAMKSSTE |
| Ga0105243_103429441 | 3300009148 | Miscanthus Rhizosphere | DIVQPPGIGIPPIADIDAHQATVTAALVAKSSAETPKKARSEDCAEAM* |
| Ga0105092_102167702 | 3300009157 | Freshwater Sediment | MRIHAMDIVQPPGMGISPIADMDAHQRIVTVALAAKRSAETPKKA* |
| Ga0114945_107638142 | 3300009444 | Thermal Springs | MRIHAIDIVQPPGIGIPPIVDMDVHQAIVTIALAA |
| Ga0105238_104082243 | 3300009551 | Corn Rhizosphere | PGIRIHAIDIVQPSGIRLPPLADMDEHQTTVTAVLAAKSRVEIP* |
| Ga0126374_109085442 | 3300009792 | Tropical Forest Soil | MRIHAIDIVQPPGIGISAIADIDAHQTIVAAALAANSNADT |
| Ga0126384_105376151 | 3300010046 | Tropical Forest Soil | GHVCPGIRIHAMDIVQPPGIGIPPIADMDPHQAIVTAALAAKRSAATPKKAR* |
| Ga0099796_100827021 | 3300010159 | Vadose Zone Soil | IRIHAIDIVQPPGIGMSAIADMDAHQTIVTAALAAKSRAETPKK* |
| Ga0074046_104565511 | 3300010339 | Bog Forest Soil | AIAIVQPPGIGISPIADMDTHQRIVTAALAAKSSAETPKKARWEAPLANHAS* |
| Ga0126370_118210531 | 3300010358 | Tropical Forest Soil | MRIHAIDIVHPPGIGIPPIADMDAPQPTVTAALAAKSSAEMPKKARSEARS* |
| Ga0126376_121250171 | 3300010359 | Tropical Forest Soil | MTHVCSGIGIHAIDIVQPPGMGISPIADMDAHQTTVTAGLTAKSSAVTHKN |
| Ga0126376_123868131 | 3300010359 | Tropical Forest Soil | IQAIDIVQPPGMGISPIADMELHQTIVTAALAAKSSAETAINACCVG* |
| Ga0126372_123662691 | 3300010360 | Tropical Forest Soil | IRIHVIDIVQPPGISIPPIADMEADQTVTAALTAKSSAEAPKKVRWDSHSPG* |
| Ga0126377_102923733 | 3300010362 | Tropical Forest Soil | MRIHAIDIVQPPGIGISPIADMDVHQTIVTALLTAKSSAETPKKA* |
| Ga0126377_117954032 | 3300010362 | Tropical Forest Soil | MRIHTIDIVQPPGIAIPPIADMDVHQAIVTAALAANSTAE |
| Ga0134128_101006651 | 3300010373 | Terrestrial Soil | MRIHAIDIVQPPGIGIAPVADMDAHRTIVTAVLAAKSAAETPRN |
| Ga0105239_106844232 | 3300010375 | Corn Rhizosphere | MRIQLIDIVQSPGIAIPPIADMDPHQRIVTAALAAKSSAEMPKNAR* |
| Ga0134124_102348283 | 3300010397 | Terrestrial Soil | RIHAIDIVQPPGIFIPPIVDMDEHHTIVTVALAAKSAADTPKKARWEACSETMP* |
| Ga0134124_116966521 | 3300010397 | Terrestrial Soil | HAIDIVQPPGIGISPVPDMDAHQTIVTAALAAKSSAEAPKNVR* |
| Ga0134127_107355301 | 3300010399 | Terrestrial Soil | PGHVWPGIRIHAIDMVQPPGIGISPIPDMDPLQAMVSAALSAKSSAETPRKAC* |
| Ga0134122_101999254 | 3300010400 | Terrestrial Soil | GIRIHAMDIVQPPGIGMSSRGDMDAHQNTVNAVLAAKSRTEAPKNAC* |
| Ga0134122_109165261 | 3300010400 | Terrestrial Soil | HAIDIVQPPGIGIPPIEDMDAHQTMVSAALAAKSSAEAPKNVR* |
| Ga0134123_102414863 | 3300010403 | Terrestrial Soil | MRIHAIDMVQSPGMGMPPDMDVHQTVVTAALLAKSSAEMPR |
| Ga0124850_11181493 | 3300010863 | Tropical Forest Soil | PGIRIHAIDIVQPPGIGISPIADMDVHQRIVAAALAAKSSAETPKRAR* |
| Ga0124844_12000081 | 3300010868 | Tropical Forest Soil | RIHTIDIVQPPGIAISPIALMDAPQRAVSTALAAKSSAETP* |
| Ga0124844_12000092 | 3300010868 | Tropical Forest Soil | IRIHTIDIVQPPGIAISPIALMDAPQRAVSTALAAKSSAETP* |
| Ga0137391_115746281 | 3300011270 | Vadose Zone Soil | PGHVCPGIRIHAIDIVQPPGIGISPIADMDAHQTIVTAALAAKSSAETP* |
| Ga0137399_116105072 | 3300012203 | Vadose Zone Soil | APGHVCPGIRIHAIDIVQPPASGISPIADMDPHQTIVTAAPAAKSSAETPKNAC* |
| Ga0137386_108975771 | 3300012351 | Vadose Zone Soil | IDIVQPPGIDIPPIADMDSHQTIVTAALAAKSRAETPKK* |
| Ga0137369_107945961 | 3300012355 | Vadose Zone Soil | MRIHAIDIGRPPGIGISPIADMHAHHTIVIAALAPKSSAE |
| Ga0137394_115507792 | 3300012922 | Vadose Zone Soil | PGIRIHAIDIVQPPGIDIPPIADMDAHATIVTAALAPNSNAETPKKARSEVRSQTMR* |
| Ga0137413_114723992 | 3300012924 | Vadose Zone Soil | MRIHAIDIVQPPGIVIPSIADMDAHQTIVTAALAAK |
| Ga0126375_120672502 | 3300012948 | Tropical Forest Soil | MRIHAIDIVQPPGIGISPIADMDAHQAIVTAALPAKRRAETPRKDAAAAGHVWP |
| Ga0157375_115639002 | 3300013308 | Miscanthus Rhizosphere | MRIHAIDIVQPPGIGIPSIDDMDAHQRTVTAALAAKSSTE |
| Ga0182024_109162462 | 3300014501 | Permafrost | MDIVQPPGIGISPMVDMELHQSTVTNALIAKRSPEMAKKARWFAFFEGE* |
| Ga0180076_10337591 | 3300014867 | Soil | RIHAIDIVQPPGIGIPPIDDMDPHQAIVTAALVAKSRHDAPRNAR* |
| Ga0157379_108510632 | 3300014968 | Switchgrass Rhizosphere | MRIHAIDIVQPPGISMFPIADMDAHHTIVTAVLRTKTNVEIPKNARSEDATRSRFSPSSK |
| Ga0137418_106780501 | 3300015241 | Vadose Zone Soil | IRIHAIDIVQPPGIGISPIADMDAHQTIVTAALAAKSSAETPKTA* |
| Ga0132258_132181451 | 3300015371 | Arabidopsis Rhizosphere | MRIHVIDIVQPPGIGIPTIVDMDAHHSIVTAALPAKSSAEMPMKVR* |
| Ga0182041_109699962 | 3300016294 | Soil | SHVCPGISIQVMDMVQPPGIGISPIVDIDPHQTIVTAVLPANSSAEMPKKVR |
| Ga0184623_100160611 | 3300018056 | Groundwater Sediment | HVCPGIRIHAIDIVQPPSIGISPIADMDAHQTIVPAALTAKSIAETPKNA |
| Ga0190265_109725581 | 3300018422 | Soil | PGIRIHAIDIVQPPGIVIPLIADMEVHQTMVTAALAAKTSTETPKNVR |
| Ga0210396_106483562 | 3300021180 | Soil | AVSSHVSPHIGIHAIDTVQPPGIGISPIADMDWHQMIVPAALVAKSRAEMPKKAR |
| Ga0210393_112636732 | 3300021401 | Soil | TIDMVQPPGIGIPPIADIGAHQTIVSAALAAKSIAEMPRKARCEEPIENHAG |
| Ga0213878_100257104 | 3300021444 | Bulk Soil | SIHVIGIVQPPGIGISPIADMDPHQLIVSAALAMKSRADMV |
| Ga0213878_101865921 | 3300021444 | Bulk Soil | IHNIDIVQPPGIGISPIADMDAHPTIVTTALAAKSSAETPKKVR |
| Ga0247693_10227991 | 3300024181 | Soil | IDIVQPPGIAISPVAGMDAHQWIVTAALAAKSSAETPKKARSDVRSETMH |
| Ga0207663_117027141 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IEIVQPPGIGISPIADMDAHLTIVTAALATTSGAETPNKAR |
| Ga0207650_102307553 | 3300025925 | Switchgrass Rhizosphere | IHAIDIVQPPGIGIPPIADIDVDQTIVTTALTAKSNAETPKKMG |
| Ga0207650_108189261 | 3300025925 | Switchgrass Rhizosphere | TAHVCPGIRIHAIDIAQPPGIGISSIPDIDAHQIIVIATLATKSSAETPRNAC |
| Ga0207709_117840661 | 3300025935 | Miscanthus Rhizosphere | DIVQPPGIGIPPIADIDAHQATVTAALVAKSSAETPKKARSEDCAEAM |
| Ga0207704_116097811 | 3300025938 | Miscanthus Rhizosphere | VCPGIRIHAIDIVQPPGIGISVIADIDADQTIETAALPVKSSAEAARNA |
| Ga0207704_119449332 | 3300025938 | Miscanthus Rhizosphere | SGIRIHAIDIVQPPGIVIPPMADMVPHQTIVAVALAAKTSVETA |
| Ga0207711_101442981 | 3300025941 | Switchgrass Rhizosphere | SSHVCPGILIHAIDIVQPPGIGISPVPDMDAHQTIVTAALAAKSSAEAPKNVR |
| Ga0207711_103125014 | 3300025941 | Switchgrass Rhizosphere | IHAIDIVQPPGIGIPPIADIDAHQATVTAALVAKSSAETPKKARSEDCAEAM |
| Ga0207661_106861441 | 3300025944 | Corn Rhizosphere | PRIRIQAIDIVQPPGIGIPPIADIDVHQTIVTAALTAKSSAATPKNA |
| Ga0207677_115332351 | 3300026023 | Miscanthus Rhizosphere | IHAIDIVQSPGIGMPLIADIDPHQAMVPAALAVKSSTDEPRNVRSEVM |
| Ga0207678_100310657 | 3300026067 | Corn Rhizosphere | MRIHAIDIVQPPGIGIAPVADMDAHRTIVTAVLAAKSAAETPRNACREPRSEVRCR |
| Ga0179593_11308601 | 3300026555 | Vadose Zone Soil | RIHAIDIVQPPGIGISPIAGMDAHQTIVTAALAAKSSAETPRNVC |
| Ga0207947_10082112 | 3300027171 | Forest Soil | TRGHVCPHMRVHVIDIDQPPGIGISPIADIDAHHMSVTVALAANSSAQMP |
| Ga0209008_11239222 | 3300027545 | Forest Soil | MGIHTIDIVQPPGIGIPCIAGMDAHQKTVNAALAANSNAETWS |
| Ga0209593_101158361 | 3300027743 | Freshwater Sediment | SHVCPGIRIHAIDIVQPPGIGIPPIADMDLHQMIVTAALAAKSSAETPKSAC |
| Ga0209701_103460582 | 3300027862 | Vadose Zone Soil | PGIRIHAIDIVQPPGIGISPIADMDAHQTIVTAALAAKSSAETP |
| Ga0208980_101092463 | 3300027887 | Wetland | RPGIRIQAIDIAQPPGIGISPIADMEAHQAIVPTAL |
| Ga0209496_106814352 | 3300027890 | Wetland | ALDHVCPGISIQDIDIVQPPGIGIPPAADIDPHQPIVAAAAAAKTSAETP |
| Ga0209068_109590912 | 3300027894 | Watersheds | VCPGMRIHAIDIDPPPGIGISPIADIHAHQRIVSPALAAKSNAATPRKTR |
| Ga0209382_113023702 | 3300027909 | Populus Rhizosphere | PGIRIHTIDIVQPPGIGIPIADMDAHPTIVSVVLTAKSNAKTPRNPAPED |
| Ga0299907_107830072 | 3300030006 | Soil | CPGIRIHAIDIVQPPGIGIPPIADMDAHQTTVAAAVTAKSSAETPKNAC |
| Ga0299913_101916964 | 3300031229 | Soil | RIHAIDIVQPPGIGIPPIADMDAHQAIVTAALAAKSSAETPKKAR |
| Ga0310888_100346593 | 3300031538 | Soil | PAHVCPGIRIHAIDIVQPPGMGIPPIADMDVHQAIVTAALATKSRAETTASAC |
| Ga0307408_1004989731 | 3300031548 | Rhizosphere | PGMRIHAIDIVQPPGIGMPPIADMDAHQTIVVAALATKSSAATPRKA |
| Ga0318548_104014732 | 3300031793 | Soil | SHVCPGITIQVMDMVQPPGIGISPIADIDPHQTIVTAVLPANSSAEMPKKVR |
| Ga0307478_105711283 | 3300031823 | Hardwood Forest Soil | VCPGIRIHAIDIVQPPGIGIPPIPDMDAPQTKVTAALAAKSSAEMPKKAC |
| Ga0310907_107326161 | 3300031847 | Soil | IDIVQLPGIGIPPSADMDWHDTIVTAAAATNSPALTPRNAEPCDACR |
| Ga0318507_103473542 | 3300032025 | Soil | PGITIQVMDMVQPPGIGISPIADIDPHQTIVTAVLPANSSAEMPKKVR |
| Ga0310890_101265413 | 3300032075 | Soil | IDIVQPPGIGISPIADMEEHQANVTAALAAKRRVETTKKAC |
| Ga0306920_1037080962 | 3300032261 | Soil | PGISIQVMDMVQPPGIGISPIADIDPHQTIVTAVLPANSSAEMPKKVP |
| Ga0318519_109732861 | 3300033290 | Soil | SHVCPGISIQVMDMVQPPGIGISPIADIDPHQTIVTAVLPANSSAEMPKKVR |
| Ga0214472_110609731 | 3300033407 | Soil | VPGQVCPGIRIHAIDIVQPPGIGIPPMPAMDAHQAIVTAALAAKSSAETPRKA |
| Ga0364931_0158442_1_156 | 3300034176 | Sediment | HVCPGIRIHAIDIVQPPGIGIPPIDDMDPHQAIVTAALVAKSRHDAPRNAR |
| ⦗Top⦘ |