| Basic Information | |
|---|---|
| Family ID | F094926 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRVSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN |
| Number of Associated Samples | 16 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.35 % |
| % of genes near scaffold ends (potentially truncated) | 34.29 % |
| % of genes from short scaffolds (< 2000 bps) | 45.71 % |
| Associated GOLD sequencing projects | 16 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.476 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (58.095 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.095 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.952 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF04934 | Med6 | 1.90 |
| PF02622 | DUF179 | 0.95 |
| PF16121 | 40S_S4_C | 0.95 |
| PF00696 | AA_kinase | 0.95 |
| PF17177 | PPR_long | 0.95 |
| PF00069 | Pkinase | 0.95 |
| PF00890 | FAD_binding_2 | 0.95 |
| PF07714 | PK_Tyr_Ser-Thr | 0.95 |
| PF13359 | DDE_Tnp_4 | 0.95 |
| PF02535 | Zip | 0.95 |
| PF00092 | VWA | 0.95 |
| PF14312 | FG-GAP_2 | 0.95 |
| PF02383 | Syja_N | 0.95 |
| PF03159 | XRN_N | 0.95 |
| PF02689 | Herpes_Helicase | 0.95 |
| PF03055 | RPE65 | 0.95 |
| PF01189 | Methyltr_RsmB-F | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.62 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.95 |
| COG3670 | Carotenoid cleavage dioxygenase or a related enzyme | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.48 % |
| All Organisms | root | All Organisms | 29.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109158204 | Not Available | 615 | Open in IMG/M |
| 3300007636|Ga0102856_1014333 | Not Available | 1126 | Open in IMG/M |
| 3300007636|Ga0102856_1017580 | Not Available | 1033 | Open in IMG/M |
| 3300008263|Ga0114349_1003563 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales | 8708 | Open in IMG/M |
| 3300008263|Ga0114349_1007086 | Not Available | 5605 | Open in IMG/M |
| 3300008263|Ga0114349_1007330 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 6002 | Open in IMG/M |
| 3300008263|Ga0114349_1013596 | All Organisms → cellular organisms → Eukaryota → Sar | 4092 | Open in IMG/M |
| 3300008263|Ga0114349_1017710 | Not Available | 3591 | Open in IMG/M |
| 3300008263|Ga0114349_1023969 | Not Available | 3072 | Open in IMG/M |
| 3300008263|Ga0114349_1027783 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 2835 | Open in IMG/M |
| 3300008263|Ga0114349_1033146 | Not Available | 2572 | Open in IMG/M |
| 3300008263|Ga0114349_1037143 | Not Available | 2412 | Open in IMG/M |
| 3300008263|Ga0114349_1052347 | Not Available | 1961 | Open in IMG/M |
| 3300008263|Ga0114349_1065775 | All Organisms → cellular organisms → Eukaryota | 4088 | Open in IMG/M |
| 3300008263|Ga0114349_1073399 | Not Available | 1578 | Open in IMG/M |
| 3300008263|Ga0114349_1083052 | Not Available | 1450 | Open in IMG/M |
| 3300008263|Ga0114349_1084079 | Not Available | 1438 | Open in IMG/M |
| 3300008263|Ga0114349_1107659 | Not Available | 1201 | Open in IMG/M |
| 3300008263|Ga0114349_1145668 | Not Available | 949 | Open in IMG/M |
| 3300008263|Ga0114349_1150661 | Not Available | 924 | Open in IMG/M |
| 3300008263|Ga0114349_1167695 | Not Available | 846 | Open in IMG/M |
| 3300008263|Ga0114349_1253264 | Not Available | 568 | Open in IMG/M |
| 3300008265|Ga0114361_1000132 | All Organisms → cellular organisms → Eukaryota | 14522 | Open in IMG/M |
| 3300008265|Ga0114361_1000208 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira | 12692 | Open in IMG/M |
| 3300008265|Ga0114361_1000211 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 12678 | Open in IMG/M |
| 3300008265|Ga0114361_1000900 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 9069 | Open in IMG/M |
| 3300008265|Ga0114361_1001807 | All Organisms → cellular organisms → Eukaryota | 7384 | Open in IMG/M |
| 3300008265|Ga0114361_1002423 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 6734 | Open in IMG/M |
| 3300008265|Ga0114361_1002504 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 6638 | Open in IMG/M |
| 3300008265|Ga0114361_1003355 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 9563 | Open in IMG/M |
| 3300008265|Ga0114361_1003698 | Not Available | 5751 | Open in IMG/M |
| 3300008265|Ga0114361_1005321 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 8071 | Open in IMG/M |
| 3300008265|Ga0114361_1005489 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales | 11052 | Open in IMG/M |
| 3300008265|Ga0114361_1006247 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 4625 | Open in IMG/M |
| 3300008265|Ga0114361_1008142 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 5559 | Open in IMG/M |
| 3300008265|Ga0114361_1008369 | Not Available | 4024 | Open in IMG/M |
| 3300008265|Ga0114361_1008849 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 3905 | Open in IMG/M |
| 3300008265|Ga0114361_1008983 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales | 3876 | Open in IMG/M |
| 3300008265|Ga0114361_1009393 | Not Available | 4192 | Open in IMG/M |
| 3300008265|Ga0114361_1009412 | Not Available | 3782 | Open in IMG/M |
| 3300008265|Ga0114361_1009433 | Not Available | 3778 | Open in IMG/M |
| 3300008265|Ga0114361_1009640 | Not Available | 3734 | Open in IMG/M |
| 3300008265|Ga0114361_1010768 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 5905 | Open in IMG/M |
| 3300008265|Ga0114361_1011638 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 3383 | Open in IMG/M |
| 3300008265|Ga0114361_1012981 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 3179 | Open in IMG/M |
| 3300008265|Ga0114361_1013145 | Not Available | 3155 | Open in IMG/M |
| 3300008265|Ga0114361_1013299 | Not Available | 3133 | Open in IMG/M |
| 3300008265|Ga0114361_1014746 | All Organisms → cellular organisms → Eukaryota | 2947 | Open in IMG/M |
| 3300008265|Ga0114361_1014799 | Not Available | 2940 | Open in IMG/M |
| 3300008265|Ga0114361_1015458 | Not Available | 2869 | Open in IMG/M |
| 3300008265|Ga0114361_1019639 | Not Available | 2461 | Open in IMG/M |
| 3300008265|Ga0114361_1019669 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 3829 | Open in IMG/M |
| 3300008265|Ga0114361_1020294 | Not Available | 2411 | Open in IMG/M |
| 3300008265|Ga0114361_1022370 | Not Available | 2257 | Open in IMG/M |
| 3300008265|Ga0114361_1022998 | Not Available | 2782 | Open in IMG/M |
| 3300008265|Ga0114361_1026583 | Not Available | 2011 | Open in IMG/M |
| 3300008265|Ga0114361_1040133 | Not Available | 1525 | Open in IMG/M |
| 3300008265|Ga0114361_1043177 | Not Available | 1454 | Open in IMG/M |
| 3300008265|Ga0114361_1046351 | Not Available | 1391 | Open in IMG/M |
| 3300008265|Ga0114361_1056449 | Not Available | 1235 | Open in IMG/M |
| 3300008265|Ga0114361_1081512 | Not Available | 1004 | Open in IMG/M |
| 3300008265|Ga0114361_1085171 | Not Available | 980 | Open in IMG/M |
| 3300008265|Ga0114361_1153284 | Not Available | 719 | Open in IMG/M |
| 3300008265|Ga0114361_1215680 | Not Available | 596 | Open in IMG/M |
| 3300020048|Ga0207193_1120089 | Not Available | 2311 | Open in IMG/M |
| 3300020505|Ga0208088_1048757 | Not Available | 506 | Open in IMG/M |
| 3300021108|Ga0214162_1060270 | Not Available | 625 | Open in IMG/M |
| 3300033984|Ga0334989_0019246 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 3612 | Open in IMG/M |
| 3300033984|Ga0334989_0042518 | Not Available | 2481 | Open in IMG/M |
| 3300033984|Ga0334989_0136231 | Not Available | 1364 | Open in IMG/M |
| 3300033984|Ga0334989_0297680 | Not Available | 859 | Open in IMG/M |
| 3300033984|Ga0334989_0456841 | Not Available | 644 | Open in IMG/M |
| 3300033984|Ga0334989_0597119 | Not Available | 530 | Open in IMG/M |
| 3300034022|Ga0335005_0030224 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | 3747 | Open in IMG/M |
| 3300034022|Ga0335005_0032610 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 3588 | Open in IMG/M |
| 3300034022|Ga0335005_0044135 | Not Available | 3029 | Open in IMG/M |
| 3300034022|Ga0335005_0063733 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 2462 | Open in IMG/M |
| 3300034022|Ga0335005_0360038 | Not Available | 846 | Open in IMG/M |
| 3300034022|Ga0335005_0360149 | Not Available | 846 | Open in IMG/M |
| 3300034022|Ga0335005_0509010 | Not Available | 668 | Open in IMG/M |
| 3300034022|Ga0335005_0617955 | Not Available | 584 | Open in IMG/M |
| 3300034022|Ga0335005_0767477 | Not Available | 502 | Open in IMG/M |
| 3300034064|Ga0335001_0592385 | Not Available | 583 | Open in IMG/M |
| 3300034064|Ga0335001_0742295 | Not Available | 510 | Open in IMG/M |
| 3300034068|Ga0334990_0148262 | Not Available | 1280 | Open in IMG/M |
| 3300034068|Ga0334990_0390662 | Not Available | 750 | Open in IMG/M |
| 3300034068|Ga0334990_0527845 | Not Available | 626 | Open in IMG/M |
| 3300034095|Ga0335022_0673048 | Not Available | 513 | Open in IMG/M |
| 3300034096|Ga0335025_0467467 | Not Available | 641 | Open in IMG/M |
| 3300034107|Ga0335037_0382183 | Not Available | 762 | Open in IMG/M |
| 3300034107|Ga0335037_0730112 | Not Available | 515 | Open in IMG/M |
| 3300034167|Ga0335017_0042082 | Not Available | 2692 | Open in IMG/M |
| 3300034167|Ga0335017_0281682 | Not Available | 931 | Open in IMG/M |
| 3300034167|Ga0335017_0295374 | Not Available | 904 | Open in IMG/M |
| 3300034167|Ga0335017_0302341 | Not Available | 891 | Open in IMG/M |
| 3300034167|Ga0335017_0477785 | Not Available | 663 | Open in IMG/M |
| 3300034168|Ga0335061_0004623 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 6869 | Open in IMG/M |
| 3300034168|Ga0335061_0006562 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 5895 | Open in IMG/M |
| 3300034168|Ga0335061_0012527 | Not Available | 4413 | Open in IMG/M |
| 3300034168|Ga0335061_0044964 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 2363 | Open in IMG/M |
| 3300034168|Ga0335061_0079252 | Not Available | 1749 | Open in IMG/M |
| 3300034168|Ga0335061_0472587 | Not Available | 641 | Open in IMG/M |
| 3300034168|Ga0335061_0592596 | Not Available | 558 | Open in IMG/M |
| 3300034168|Ga0335061_0627172 | Not Available | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 58.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 36.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.90% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1091582041 | 3300002408 | Freshwater | FAIIVSFMLFTVLFPLVYVLYFEEFLIHDSRGFMILKKI* |
| Ga0102856_10143332 | 3300007636 | Estuarine | RVSLIFVIIISFMLFTVFSLVYVLYFEELLIHDSRGFMILKNN* |
| Ga0102856_10175802 | 3300007636 | Estuarine | WAGGIVRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKKI* |
| Ga0114349_10035639 | 3300008263 | Freshwater, Plankton | MQVSLIFAIILSFMLFTVFTLANVLYFEEFLIYDSRGFMILKNS* |
| Ga0114349_10070867 | 3300008263 | Freshwater, Plankton | MEEPRAIFATIVSFLLFTVFLLVYVLYFEEFLFHNSCGFMILKKN* |
| Ga0114349_10073302 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIVSFMLFTVFSLVNVLYFEEFLIHDSRGFMILKKI* |
| Ga0114349_10135967 | 3300008263 | Freshwater, Plankton | VRVSLIFALIVSFMLFTVFPLVYVLYLEEFLIHDSRGFMILKKI* |
| Ga0114349_10177101 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIISFLLFTVFTLVYVLYFEECQIHDSRGFMILKNN* |
| Ga0114349_10239694 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIVSFMLFTVFTLAIVLYSRGFMILKNN* |
| Ga0114349_10277834 | 3300008263 | Freshwater, Plankton | LVRVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSREFMSLKKT* |
| Ga0114349_10331463 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIISFMLFTVFTLANVLYFEEFMIHESRGFMILKNN* |
| Ga0114349_10371436 | 3300008263 | Freshwater, Plankton | VQVSLIFGIIVSFMLFTVFTLANVLYFEEFMIHDSREFIILENN* |
| Ga0114349_10523473 | 3300008263 | Freshwater, Plankton | MQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKNGIL* |
| Ga0114349_10657751 | 3300008263 | Freshwater, Plankton | VQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFVILKKI* |
| Ga0114349_10733991 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIVSFMLFTYSTVFLLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114349_10830521 | 3300008263 | Freshwater, Plankton | SLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMI* |
| Ga0114349_10840794 | 3300008263 | Freshwater, Plankton | VDPSSTVDMRVSPIFAIIVRFMLFTVFTLANLLYFEEFLIHDSHGFIILKNN* |
| Ga0114349_11076592 | 3300008263 | Freshwater, Plankton | VRDSLIFAIIVSFMLFTVFPLVHVLCIEDFLIHDSRGFMILKKNDQI |
| Ga0114349_11456683 | 3300008263 | Freshwater, Plankton | FVIIVSFMLFTMFPLIYVLYFEEFLIHDSHGFMILKKI* |
| Ga0114349_11506611 | 3300008263 | Freshwater, Plankton | VRVSLVFVIIVSFMLFTVFTLVYVLYFEEFLIHDSRG |
| Ga0114349_11676952 | 3300008263 | Freshwater, Plankton | VRVSLIFAIIISFMIFTVFPLIYVLYFEEFLIHDSRGFMILK |
| Ga0114349_12532641 | 3300008263 | Freshwater, Plankton | MEEHVRVSLIFAIIISFMLFTMFTLVHVFYFEEFLIHDSRGFMILKNS* |
| Ga0114361_100013212 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIVSFMLFTVFPLVYVFYVEEFLIHDSRGFMILKYN* |
| Ga0114361_100020811 | 3300008265 | Freshwater, Plankton | MCEFPRFFAKIVSFMLFTVFTLVYVLYFKEFLIHDSRGFVILKNS* |
| Ga0114361_10002111 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIISFMLFTMFPLANVFYFEEFLIHNSRGFMILKNN* |
| Ga0114361_100090014 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIVSFMLFTVFPLDNVLYFEEFLIHDSRGFMILKNK* |
| Ga0114361_10018075 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIVSFMLPFEEFLIHNSRGFMILKKIGPNLLGLCYFPLNT* |
| Ga0114361_10024236 | 3300008265 | Freshwater, Plankton | VRVSLIFVIIVSFMLFTLFPLVYVLYFEEFLIQDSRGFMILKNN* |
| Ga0114361_10025045 | 3300008265 | Freshwater, Plankton | VQILHSPARGLEEHVRVSLIFVIIISFMLFTVFTLIYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10033555 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIISFMLFTVFTLVYVLYSEEFMIHDSRGFMILKNN* |
| Ga0114361_10036984 | 3300008265 | Freshwater, Plankton | VSVLEEHVRVSLIFAIITSFMLLTVFTLIYILYFEEFPIRDSRGFMIVKNN* |
| Ga0114361_100532112 | 3300008265 | Freshwater, Plankton | MRVSLIFAIIVSFMLFTVFTFANVLYSEEFLIHDSRGFMIWKNN* |
| Ga0114361_10054897 | 3300008265 | Freshwater, Plankton | VRVSLVFVIIVSFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10062472 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIVSFLLFIVFVYVLYFEEFLIHDSRGFMTLKNN* |
| Ga0114361_10081424 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIVSFMLFRYSTVFPLVYVLNFEEFLIHDSHGFMILKNN* |
| Ga0114361_10083692 | 3300008265 | Freshwater, Plankton | MRVGWRNLVRVSLIFAIIVIFMLFAVFPLVYVLYFEEFMILHSRGFMILKNN* |
| Ga0114361_10088491 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIVSFMLFTVFSLVYVLYFEEFLIHDSRGFMILKKI* |
| Ga0114361_10089832 | 3300008265 | Freshwater, Plankton | MRVSLIFVIIISFMFFTVFTLVYVLYFEDFLFRDSHGFIILKIN* |
| Ga0114361_10093931 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIISFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10094123 | 3300008265 | Freshwater, Plankton | MLFTYSTVFLLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10094333 | 3300008265 | Freshwater, Plankton | VRVPQIFAIIVSFLLFTVFPFVYVLYFEEFLIHDSLGFMILKKI* |
| Ga0114361_10096407 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIVSFMLFTVFFLVYVLYFKEFLIHDSRGFMILKNN* |
| Ga0114361_10107686 | 3300008265 | Freshwater, Plankton | VRVPLIFAIIVSFLLLFTTVFPLVYVLYFEEFLIHDSRGFMILKKI* |
| Ga0114361_10116385 | 3300008265 | Freshwater, Plankton | VRVSLIFAIFVSFMLFSEFPLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10129816 | 3300008265 | Freshwater, Plankton | MGWAEGKHHVRVSLIFAIIVSFMLFTVFTLVYVLYFEEFPIHNSRGFMILKNN* |
| Ga0114361_10131453 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIISFMLFTVFPLAYVLYFEEFLIHDSCGFVILKKI* |
| Ga0114361_10132992 | 3300008265 | Freshwater, Plankton | VRVPLIFAIIVSFMLFTVFPLIYVLYFEEFLIHNSRGFMILKKI* |
| Ga0114361_10147464 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIISFILFTVFPLVYVLFFEEVLIHDSLGFMILKYI* |
| Ga0114361_10147994 | 3300008265 | Freshwater, Plankton | VRVSLIFVIIISFMLFTVFPLVYVLYLEEFLIHDSRGFMILKKI* |
| Ga0114361_10154581 | 3300008265 | Freshwater, Plankton | MQVSLIFAIIVSFMLFTVANVLYFEEFMIQDSPGFMILKNN* |
| Ga0114361_10196391 | 3300008265 | Freshwater, Plankton | VRVSLIFVIVVSFVLFTVFPLIYILYFEEFLIHDSRGFMILKKI* |
| Ga0114361_10196691 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIVSFMLFTVFSLMYVLYFEEFLIHDSRGFMILKKI* |
| Ga0114361_10202943 | 3300008265 | Freshwater, Plankton | VRVSLIFAMIVSFMLFTVFTLVYVLYFEEFLIHDSRGFMILKNN* |
| Ga0114361_10223703 | 3300008265 | Freshwater, Plankton | VRVSLIFAIIISFMLFTVFPLVYELYFEEFLIHDSHGFVILKKI* |
| Ga0114361_10229981 | 3300008265 | Freshwater, Plankton | VRVSLIVAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKNY* |
| Ga0114361_10265833 | 3300008265 | Freshwater, Plankton | MGWRNLERVSLIYAIIVSFLLFTVFPLVYVLYFKEFLIQDSRGFMILKKI* |
| Ga0114361_10401332 | 3300008265 | Freshwater, Plankton | VRVSLIFGIIVSFMLFTVFTLVYELYFEKILIHNSRGFMILKNS* |
| Ga0114361_10431772 | 3300008265 | Freshwater, Plankton | VGWRNLVQVSVIFAVIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNN* |
| Ga0114361_10463513 | 3300008265 | Freshwater, Plankton | IIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKKI* |
| Ga0114361_10564493 | 3300008265 | Freshwater, Plankton | FAIIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNT* |
| Ga0114361_10815123 | 3300008265 | Freshwater, Plankton | RVSLIFVIIISFMIFTVFTVANVLYFEEFLIQDSPGFMILKNN* |
| Ga0114361_10851711 | 3300008265 | Freshwater, Plankton | FAIIVSFMLFTVFPLVYVLYFKEFLIHDSRGFMILKNN* |
| Ga0114361_11532841 | 3300008265 | Freshwater, Plankton | VQVSLIFAIIVSLMLFTVLTLVYVLYFEEFLIHDSRGFMILKIN* |
| Ga0114361_12156801 | 3300008265 | Freshwater, Plankton | MRVSLIFAIIVSFMLLTVFPLVYVLYFEEFLINDSRGFMILKNI* |
| Ga0207193_11200892 | 3300020048 | Freshwater Lake Sediment | MWAGGTSANYPDFSRIIIFMLFTVFTLIYILYFEELLIHDSRGFMILKNN |
| Ga0208088_10487571 | 3300020505 | Freshwater | MQVSLIFAIILSFMLFTVFTLANVLNFEEFLIHDSRGIMILKNN |
| Ga0214162_10602701 | 3300021108 | Freshwater | IIVSFMLFTVLFPLVYVLYFEEFLIHDSRGFMILKKI |
| Ga0334989_0019246_1911_2045 | 3300033984 | Freshwater | MRVSLNFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN |
| Ga0334989_0042518_279_413 | 3300033984 | Freshwater | MRVSLIFAIIVSFMLFNVFALANELYFEEFLNHDSRGFMILKNN |
| Ga0334989_0136231_625_759 | 3300033984 | Freshwater | MQVSLIFVIIVSFMLFTVFTLANELYFDEFLIHDSRGFIILKNN |
| Ga0334989_0297680_93_227 | 3300033984 | Freshwater | MRVSLIFAIIVSFMLFTVFTLAYVLYFEEFLIRDSRGFMILKNN |
| Ga0334989_0456841_3_128 | 3300033984 | Freshwater | TLIFSRIISFMLFTVFTLPSVLYFEEFLIHYSRGFMSLKNN |
| Ga0334989_0597119_370_528 | 3300033984 | Freshwater | ACGLEEHIMLVSLIFVIFVSFMFFIVFTLANVLYFEEFLIHDSCGFMILKNN |
| Ga0335005_0030224_3426_3560 | 3300034022 | Freshwater | MRVSLIFVIIISFKLFNVFTLANVLYFEEFLIHDSRGSMILKNN |
| Ga0335005_0032610_1642_1776 | 3300034022 | Freshwater | MQVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSCGFMILKNS |
| Ga0335005_0044135_2_127 | 3300034022 | Freshwater | SLIFAIIVSFMLFTVFTLANVFYSEEFLINNSGGFMILKNN |
| Ga0335005_0063733_10_144 | 3300034022 | Freshwater | MRVSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN |
| Ga0335005_0360038_1_153 | 3300034022 | Freshwater | RGLEEHVRVSLIFAIIISFMLFTVFTLANVLYFKAFMIHDSRGFMILKNN |
| Ga0335005_0360149_721_846 | 3300034022 | Freshwater | FLIFAIIVIFMSFTVFTLANVLYFQEFMNHESCGFMILKNN |
| Ga0335005_0509010_555_668 | 3300034022 | Freshwater | AIIVSLMLFTVFTLANVLYFEEFLIHDSRGFIILKNN |
| Ga0335005_0617955_2_124 | 3300034022 | Freshwater | LIFAIIISFMLFIVVTLANVLYFEEFMIHYSRGFMILKNN |
| Ga0335005_0767477_3_113 | 3300034022 | Freshwater | IIVSFMLFTVFTLANVLYFEEFMIHDSCGFMILKNN |
| Ga0335001_0592385_2_109 | 3300034064 | Freshwater | MQVSLIFAIIISFMLYTVFTLANILYFEEFLIHDSR |
| Ga0335001_0742295_402_509 | 3300034064 | Freshwater | IVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNS |
| Ga0334990_0148262_1152_1280 | 3300034068 | Freshwater | VSLIFVIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNN |
| Ga0334990_0390662_629_748 | 3300034068 | Freshwater | MRVSLIFAIIVSFMLFTMFTLAYVLYFEEFLIHYSCGFYD |
| Ga0334990_0527845_475_624 | 3300034068 | Freshwater | AGEEHVRVSLIFAIIVSFMLFTVFTLANVLYFEEFMIHDSRGFMILKNN |
| Ga0335022_0673048_3_131 | 3300034095 | Freshwater | VSLIFVIIVSFMLFTAFTLANVLYFKEFLIHDSRGFMILKNN |
| Ga0335025_0467467_531_641 | 3300034096 | Freshwater | LIFVIIVSFMLCTVFTLVYVFYFEEFLIHDSRGFMI |
| Ga0335037_0382183_1_129 | 3300034107 | Freshwater | MQVSLIFAIIVSFMLFTVFPLVYVLYFEEFLIHDSRGFMILKN |
| Ga0335037_0730112_233_388 | 3300034107 | Freshwater | MRGLEEHVRVSLNFAIIVSFMFFSVFTLANVLYFEEFLIHDSCGFMILKNN |
| Ga0335017_0012327_1717_1908 | 3300034167 | Freshwater | MVTLTASGLEDHMQVSLIFAIIVSLMFFTVFTVFTVFTLAYVLYFEEFLIHDSHGFIILKNTN |
| Ga0335017_0042082_1399_1533 | 3300034167 | Freshwater | MQVSQIFAIIVSFMLFTVFTLANVLCFEEFLIHDSRGFMILKNN |
| Ga0335017_0281682_786_929 | 3300034167 | Freshwater | MRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFMILKNICLNL |
| Ga0335017_0295374_86_220 | 3300034167 | Freshwater | MRVSLIFAIIVSFLLFTVFTLASVLYFEEFLIHDSCGFMIFKNN |
| Ga0335017_0302341_73_207 | 3300034167 | Freshwater | MRVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSRGFLILKNN |
| Ga0335017_0477785_556_663 | 3300034167 | Freshwater | IVSFMFFTVFTLANVLYLEEFMIHDSRGFMILKNN |
| Ga0335061_0004623_4088_4243 | 3300034168 | Freshwater | MRGLEEHMQVSLIFAIIVSFMLFTVFTLANVLYFEEFLIHDSCGFMILKNS |
| Ga0335061_0006562_4707_4841 | 3300034168 | Freshwater | MRVSLIFAIIVSFMLFTVFTLANVLYIEEFLIRNSRGFMILKNN |
| Ga0335061_0012527_3785_3919 | 3300034168 | Freshwater | MRVSLIFTIIVSYMLFTVFTVANVLYFEEFLIHDSRGFMILKNS |
| Ga0335061_0044964_2126_2260 | 3300034168 | Freshwater | MRVFLIFAITVSFMLFTVFTLANVLYFEEFLIHDSRGFLILKNH |
| Ga0335061_0079252_1588_1749 | 3300034168 | Freshwater | LAAHGLEEHVRVSLIFAIIISFMLFTVFTLANVLYFKAFMIHDSRGFMILKNN |
| Ga0335061_0472587_504_641 | 3300034168 | Freshwater | IMRVSLIFAIIVSFMLFTVITLANVLYFEEFLIHDSCEFMILKNN |
| Ga0335061_0592596_405_539 | 3300034168 | Freshwater | MQVSLIFAIIVSFMLFTEFTLANVLYFKAFLIHDSRGFMVLKNS |
| Ga0335061_0627172_160_294 | 3300034168 | Freshwater | MRVSLIFVIIVSFMLFTVFTLANVLYFEEFTIHDSSGFMIMKNN |
| ⦗Top⦘ |