Metagenome / Metatranscriptome Family F094818

Overview

Basic Information

• Family ID: F094818
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 105
• Average Sequence Length: 43 residues
• Representative Sequence: DLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP
• Number of Associated Samples: 68
• Number of Associated Scaffolds: 105

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.95 %
• % of genes near scaffold ends (potentially truncated): 90.48 %
• % of genes from short scaffolds (< 2000 bps): 99.05 %
• Associated GOLD sequencing projects: 68
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (86.667 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (71.429 % of family members)
• Environment Ontology (ENVO): Unclassified (94.286 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (85.714 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 45.83%
  β-sheet: 0.00%
  Coil/Unstructured: 54.17%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
All Organisms	root	All Organisms	13.33 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
cellular organisms	root	All Organisms → cellular organisms	13.33 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.33 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.33 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.33 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.33 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.33 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	13.33 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	13.33 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	13.33 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13.33 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	13.33 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	13.33 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	13.33 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	13.33 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	13.33 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	13.33 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	13.33 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	13.33 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	12.38 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.95 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	12.38 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	12.38 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	12.38 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	11.43 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.95 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.67 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	11.43 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.95 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009092|Ga0105250_10402109	Not Available	607
3300009972|Ga0105137_102573	Not Available	764
3300009972|Ga0105137_104496	Not Available	657
3300009976|Ga0105128_108763	Not Available	669
3300009980|Ga0105135_112306	Not Available	676
3300009981|Ga0105133_106703	Not Available	787
3300009981|Ga0105133_110328	Not Available	702
3300009981|Ga0105133_113997	Not Available	648
3300009989|Ga0105131_101795	Not Available	1432
3300009989|Ga0105131_102096	Not Available	1341
3300009989|Ga0105131_115510	Not Available	706
3300009989|Ga0105131_128042	Not Available	590
3300009990|Ga0105132_106195	Not Available	896
3300009990|Ga0105132_114931	Not Available	709
3300009990|Ga0105132_135434	Not Available	549
3300009990|Ga0105132_136925	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	541
3300009994|Ga0105126_1005096	Not Available	1100
3300009995|Ga0105139_1007571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1304
3300009995|Ga0105139_1040525	Not Available	789
3300009995|Ga0105139_1043476	Not Available	770
3300009995|Ga0105139_1045551	Not Available	758
3300010396|Ga0134126_12459097	Not Available	566
3300010397|Ga0134124_10655588	Not Available	1034
3300010399|Ga0134127_13006050	Not Available	550
3300010400|Ga0134122_10724806	Not Available	938
3300014968|Ga0157379_12177893	Not Available	550
3300015273|Ga0182102_1017090	Not Available	658
3300015278|Ga0182099_1059588	Not Available	536
3300015280|Ga0182100_1025626	Not Available	786
3300015280|Ga0182100_1034178	Not Available	721
3300015280|Ga0182100_1064079	Not Available	588
3300015284|Ga0182101_1028931	Not Available	756
3300015284|Ga0182101_1064378	Not Available	587
3300015284|Ga0182101_1091338	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	519
3300015290|Ga0182105_1002156	Not Available	1608
3300015293|Ga0182103_1022110	Not Available	811
3300015293|Ga0182103_1031908	Not Available	731
3300015297|Ga0182104_1070582	Not Available	611
3300015297|Ga0182104_1089527	Not Available	562
3300015306|Ga0182180_1030739	Not Available	753
3300015306|Ga0182180_1032661	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	736
3300015309|Ga0182098_1123435	Not Available	510
3300015311|Ga0182182_1039164	Not Available	747
3300015312|Ga0182168_1069896	Not Available	652
3300015315|Ga0182120_1059055	Not Available	697
3300015315|Ga0182120_1073320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	645
3300015315|Ga0182120_1076139	Not Available	636
3300015317|Ga0182136_1008394	Not Available	1275
3300015317|Ga0182136_1058553	Not Available	700
3300015318|Ga0182181_1073928	Not Available	588
3300015319|Ga0182130_1118241	Not Available	533
3300015324|Ga0182134_1033526	Not Available	863
3300015324|Ga0182134_1059330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	712
3300015324|Ga0182134_1137634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	518
3300015325|Ga0182148_1066685	Not Available	675
3300015326|Ga0182166_1063975	Not Available	682
3300015327|Ga0182114_1075344	Not Available	686
3300015328|Ga0182153_1013331	Not Available	1148
3300015328|Ga0182153_1065200	Not Available	695
3300015329|Ga0182135_1114822	Not Available	568
3300015330|Ga0182152_1073274	Not Available	674
3300015331|Ga0182131_1087788	Not Available	633
3300015332|Ga0182117_1076063	Not Available	704
3300015333|Ga0182147_1103285	Not Available	617
3300015334|Ga0182132_1086953	Not Available	663
3300015335|Ga0182116_1114333	Not Available	613
3300015336|Ga0182150_1090619	Not Available	642
3300015337|Ga0182151_1039652	Not Available	860
3300015337|Ga0182151_1044840	Not Available	826
3300015337|Ga0182151_1152042	Not Available	522
3300015338|Ga0182137_1031683	Not Available	987
3300015338|Ga0182137_1169012	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	515
3300015338|Ga0182137_1179530	Not Available	501
3300015339|Ga0182149_1113402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	602
3300015340|Ga0182133_1036733	Not Available	962
3300015350|Ga0182163_1189537	Not Available	644
3300015350|Ga0182163_1295398	Not Available	507
3300015352|Ga0182169_1268980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	552
3300015352|Ga0182169_1296431	Not Available	522
3300015354|Ga0182167_1223456	Not Available	685
3300015354|Ga0182167_1251890	Not Available	636
3300017408|Ga0182197_1059260	Not Available	719
3300017408|Ga0182197_1133354	Not Available	528
3300017414|Ga0182195_1099453	Not Available	692
3300017421|Ga0182213_1079406	Not Available	905
3300017445|Ga0182198_1099884	Not Available	662
3300017445|Ga0182198_1109422	Not Available	640
3300017447|Ga0182215_1082818	Not Available	704
3300017447|Ga0182215_1111012	Not Available	616
3300017693|Ga0182216_1188596	Not Available	539
3300017693|Ga0182216_1226724	Not Available	500
3300017694|Ga0182211_1113510	Not Available	637
3300028049|Ga0268322_1042336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	558
3300028050|Ga0268328_1008011	Not Available	1028
3300028056|Ga0268330_1042168	Not Available	582
3300028152|Ga0268336_1012672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	662
3300032464|Ga0214492_1000247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	4441
3300032464|Ga0214492_1084139	Not Available	603
3300032467|Ga0214488_1092672	Not Available	659
3300032590|Ga0214489_1072125	Not Available	507
3300032625|Ga0214501_1274697	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	533
3300032792|Ga0314744_1073719	Not Available	658
3300032824|Ga0314735_1064863	Not Available	690
3300033533|Ga0314770_1294101	Not Available	508
3300033535|Ga0314759_1041081	Not Available	1352

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.19%
Environmental	Environmental	3.81%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.19%
Terrestrial	Environmental → Terrestrial	3.81%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	75.24%
Unclassified	Host-Associated → Plants → Unclassified	19.05%
Soil	Environmental → Terrestrial → Soil	3.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.90%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	75.24%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	19.05%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.90%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	75.24%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	19.05%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.90%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	71.43%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	19.05%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.81%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	3.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.95%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032590	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)	Host-Associated
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033533	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105250_104021092	3300009092	Switchgrass Rhizosphere	CHGLLPYEYHHLESVDESGTQVWSELSLADEYVLSDVTAAVAPPEPEDP*
Ga0105137_1025731	3300009972	Switchgrass Associated	PCEYHHLESVDESGTQVWSELSLADEYALSDVTAAVAPPRPEDP*
Ga0105137_1044962	3300009972	Switchgrass Associated	AVHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTTAVAPPEPEDL*
Ga0105128_1087631	3300009976	Switchgrass Associated	AAAVHDLLPSVCHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0105135_1123061	3300009980	Switchgrass Associated	VVVSGTQVWSELSLADEHILSDVTAAVAPPEPEDP*
Ga0105133_1067032	3300009981	Switchgrass Associated	VDESGTQVWSVMSLASEYVLNDVTAAVAPPESEDP*
Ga0105133_1103281	3300009981	Switchgrass Associated	HHLESEDESGTQVWSELSEYVLSDVTAAVAPPEPEDP*
Ga0105133_1139971	3300009981	Switchgrass Associated	LESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESTDL*
Ga0105131_1017951	3300009989	Switchgrass Associated	LLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0105131_1020961	3300009989	Switchgrass Associated	VHDLLPSEYHYLESVDESGTQVWSELSEYVLSDVTAAVAPPEPEDL*
Ga0105131_1155102	3300009989	Switchgrass Associated	HHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL*
Ga0105131_1280421	3300009989	Switchgrass Associated	SECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP*
Ga0105132_1061952	3300009990	Switchgrass Associated	PSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL*
Ga0105132_1149312	3300009990	Switchgrass Associated	LPSEYHHLESMDESGTQVRSELSEYVLSDVTADVAPPEPEDL*
Ga0105132_1354341	3300009990	Switchgrass Associated	VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPPEPEDP*
Ga0105132_1369251	3300009990	Switchgrass Associated	VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEA
Ga0105126_10050963	3300009994	Switchgrass Associated	VHDLLPSEYHHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP*
Ga0105139_10075712	3300009995	Switchgrass Associated	VHGLLPSEYHHLESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEDP*
Ga0105139_10405251	3300009995	Switchgrass Associated	HCHGLLPCEYHHLESVDESGTQVWSKLALADEYVLSDVTAVVAHHEPEDP*
Ga0105139_10434762	3300009995	Switchgrass Associated	HLESVDVSGTQVWSELSEYVLSDVTAAMAPPEPEDL*
Ga0105139_10455512	3300009995	Switchgrass Associated	AAVHDLLPSEYHHLESVDVSRTQVWSELSEYILSDVTAVVAPPEPEDL*
Ga0134126_124590972	3300010396	Terrestrial Soil	RCAAVHGLLPSECHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL*
Ga0134124_106555881	3300010397	Terrestrial Soil	CHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0134127_130060501	3300010399	Terrestrial Soil	ESVDVSGTQVWPELSEYVLSDVTAGVAPPEPKDP*
Ga0134122_107248061	3300010400	Terrestrial Soil	GLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP*
Ga0157379_121778931	3300014968	Switchgrass Rhizosphere	HHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL*
Ga0182102_10170901	3300015273	Switchgrass Phyllosphere	WHHLESVDESGTQVWYELSLAVEYALSDVTAAVAPPEPEDP*
Ga0182099_10595882	3300015278	Switchgrass Phyllosphere	LPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0182100_10256262	3300015280	Switchgrass Phyllosphere	LPSECHHLESVDESGTQVWPELSEYVLSDVTAAVAPPEPEAP*
Ga0182100_10341783	3300015280	Switchgrass Phyllosphere	SECHHLESVDVSGTQVRSELSEYVLSDETAAVAPHEPEDP*
Ga0182100_10640791	3300015280	Switchgrass Phyllosphere	VPLSEYPHLESVDESGTGVWSVQPLADEYALSDVTAAPPEPEDP*
Ga0182101_10289313	3300015284	Switchgrass Phyllosphere	VDESGTQVWSVPSLADEYVLNDVTAVVAPPESEDP*
Ga0182101_10643782	3300015284	Switchgrass Phyllosphere	VHDLLPSEYYHLESVDEYGTQVRSMPSEYVLIDVTAAVAPPEPEDP*
Ga0182101_10913381	3300015284	Switchgrass Phyllosphere	VHGLLPSEYHHLESVDESGTQVWSVPSLDDEYVLNDVTAAVAPPE
Ga0182105_10021563	3300015290	Switchgrass Phyllosphere	ESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP*
Ga0182103_10221103	3300015293	Switchgrass Phyllosphere	CAAAVHDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPLEPEDP*
Ga0182103_10319081	3300015293	Switchgrass Phyllosphere	ESMDASGTQVWSELSEYVLSDVTAAVAPPEPEDP*
Ga0182104_10705822	3300015297	Switchgrass Phyllosphere	ESVDESGTQVWSELSLADEYVLGDVTAAVAPPEPEDP*
Ga0182104_10895272	3300015297	Switchgrass Phyllosphere	VHALLSVDESGTQVWSELSEYVLSDVTAAVAPPESEDP*
Ga0182180_10307391	3300015306	Switchgrass Phyllosphere	LESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEGP*
Ga0182180_10326611	3300015306	Switchgrass Phyllosphere	VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPE
Ga0182098_11234351	3300015309	Switchgrass Phyllosphere	LLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL*
Ga0182182_10391642	3300015311	Switchgrass Phyllosphere	VHDLLPSEYYHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP*
Ga0182168_10698961	3300015312	Switchgrass Phyllosphere	ECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL*
Ga0182120_10590551	3300015315	Switchgrass Phyllosphere	VHDLLLSEYYHLESVDEYGTQVRSVLSKYVLSDVTAAVAPPESEDL*
Ga0182120_10733201	3300015315	Switchgrass Phyllosphere	VHGLLLSEYHHLESVDESGTQAWSVPSLADEYVLNDVTAAVA
Ga0182120_10761391	3300015315	Switchgrass Phyllosphere	DLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP*
Ga0182136_10083941	3300015317	Switchgrass Phyllosphere	ECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPELEAP*
Ga0182136_10585532	3300015317	Switchgrass Phyllosphere	HDLLPSVCHHLESMDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0182181_10739282	3300015318	Switchgrass Phyllosphere	HDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP*
Ga0182130_11182411	3300015319	Switchgrass Phyllosphere	AVHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL*
Ga0182134_10335262	3300015324	Switchgrass Phyllosphere	EFHHLESVDESGTQAWRSELSLADEYVLSDVTATVAPPEPEDPRS*
Ga0182134_10593301	3300015324	Switchgrass Phyllosphere	VHDLLPSEYYHLEFVDESGTQVRSVLSEYVLSDVTAAVAPPEPEDP*
Ga0182134_11376341	3300015324	Switchgrass Phyllosphere	VHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAA
Ga0182148_10666851	3300015325	Switchgrass Phyllosphere	RCAAAVHDLLPSECHHLESVDVSGTQVWPELSEYIPSDVTAAVAPPEPEDP*
Ga0182166_10639752	3300015326	Switchgrass Phyllosphere	LPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP*
Ga0182114_10753442	3300015327	Switchgrass Phyllosphere	CAAAVHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL*
Ga0182153_10133311	3300015328	Switchgrass Phyllosphere	CAAAAVHDLLPSEYYHLESVDEYGTQVRSVLSEYILSDVTAAVAPPESEDL*
Ga0182153_10652001	3300015328	Switchgrass Phyllosphere	HHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP*
Ga0182135_11148221	3300015329	Switchgrass Phyllosphere	AAAVSDLLPSEYHHLESVDESGTQVWSELSEYVLSDVTAAVAPPESEDP*
Ga0182152_10732741	3300015330	Switchgrass Phyllosphere	SEYHHLESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEDP*
Ga0182131_10877881	3300015331	Switchgrass Phyllosphere	LESVDVSGTQVWSELSEYVRSDITAAVAPPEPEDP*
Ga0182117_10760631	3300015332	Switchgrass Phyllosphere	HCHSLVPCEYHHLESEDKSGTQVWSELSLAGEYALSDITAAVAHPEPEDP*
Ga0182147_11032852	3300015333	Switchgrass Phyllosphere	CHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP*
Ga0182132_10869531	3300015334	Switchgrass Phyllosphere	LESVDVSGTQVWPELSEYVLSDVTAVVAPPKPEDL*
Ga0182116_11143332	3300015335	Switchgrass Phyllosphere	ESVDESGTQVWSELSLADEYVLSDVTATVAPPEPEDP*
Ga0182150_10906192	3300015336	Switchgrass Phyllosphere	YHHLESVDETGTQVWSELSLADEYALSDVTAAVAPPEPEDP*
Ga0182151_10396521	3300015337	Switchgrass Phyllosphere	LPCEYHHLESVDVSGTQVWSELSEYVLSDVTANVAPPEPEDL*
Ga0182151_10448401	3300015337	Switchgrass Phyllosphere	AAVHDLLPSEYHHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP*
Ga0182151_11520421	3300015337	Switchgrass Phyllosphere	AAAVPDLLPSEYHHLESLDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL*
Ga0182137_10316831	3300015338	Switchgrass Phyllosphere	ECHHLESVDVSGTQVWPELPEYVLSDVTAAVAPPEPEDP*
Ga0182137_11690122	3300015338	Switchgrass Phyllosphere	VHDLLPSEYHHLESVDETGTQVWSELSLADEYALSDVT
Ga0182137_11795302	3300015338	Switchgrass Phyllosphere	EFVDEYGTQVRSVLSEYVLSDVTAAVAPPEPKDP*
Ga0182149_11134022	3300015339	Switchgrass Phyllosphere	VYDLLPSEYYHLESVDEYGAQVRSVLSEYVVSDVTAAVAPP
Ga0182133_10367332	3300015340	Switchgrass Phyllosphere	LLPCEYYHLESVDEYGTQVRSVLSEYVLSDVTAAVAPPEPEDP*
Ga0182163_11895371	3300015350	Switchgrass Phyllosphere	LESVDESGTQVWSELSLADEYALSDVTAVVAPPEPEDP*
Ga0182163_12953981	3300015350	Switchgrass Phyllosphere	HHLESVDESGTQVWSELSEYVLSDVTAAVAPPEPEDP*
Ga0182169_12689801	3300015352	Switchgrass Phyllosphere	VDESGTQVWPELSLADEYVLSDVTAAVAPPKPEDPSSEAN
Ga0182169_12964311	3300015352	Switchgrass Phyllosphere	VHDLLPSEYYHLESVDESGTQVRSVLSEYVLSDVIVAVAPPEPEDP*
Ga0182167_12234561	3300015354	Switchgrass Phyllosphere	YHHLESVDVSGTQVWSELSEYVLSDVTAAVAPSESEDL*
Ga0182167_12518901	3300015354	Switchgrass Phyllosphere	VHDLLPSEYHHLESVDESETQVRSELSEYVLSDVTAAVAPPVPEDL*
Ga0182197_10592603	3300017408	Switchgrass Phyllosphere	HDRLPSECHHLESVDVSGTQVLSELSEYVLSNVTTAVAPPESEDP
Ga0182197_11333541	3300017408	Switchgrass Phyllosphere	CAAAAVHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPPEPEDP
Ga0182195_10994531	3300017414	Switchgrass Phyllosphere	HGLLPCEYHHLESVVQSGTEVRSELSLADAYALSDVTAAVAPPEPEDP
Ga0182213_10794061	3300017421	Switchgrass Phyllosphere	WCAAAVHDLLPSKCHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPESEDP
Ga0182198_10998841	3300017445	Switchgrass Phyllosphere	AAAVHDLLPSEYHHLESVDESGTQVWSVLSLANEYVLNDVTAAMAPPESEDP
Ga0182198_11094221	3300017445	Switchgrass Phyllosphere	PSEYPHLESVDESGTQVWSELSLADGYVLSYVTAVVAPHEPEDP
Ga0182215_10828181	3300017447	Switchgrass Phyllosphere	HHLESVDESGTQVWSELSLADEYVLSNVTAAVAPPEPEDP
Ga0182215_11110121	3300017447	Switchgrass Phyllosphere	LESVDESGTQVWSELSEYVLSDITAAVAPPEPEDL
Ga0182216_11885961	3300017693	Switchgrass Phyllosphere	PSDLLPSEYPHLESVDESGTQVWSELSEYVLSEVTAAVAPPKPEDL
Ga0182216_12267241	3300017693	Switchgrass Phyllosphere	LESVDVSGTPVWYELSLSDENVLSDIAAAVAPPEPEDP
Ga0182211_11135102	3300017694	Switchgrass Phyllosphere	DLLPSEYYHLESVDEYRTQVRSVLSKYVLSDVTAAVAPPELEDP
Ga0268322_10423361	3300028049	Phyllosphere	VHDLLPCRYHHLESVDESGTQVWSVLSLADEYVLNNVTTAVAPPES
Ga0268328_10080112	3300028050	Phyllosphere	HLESVDVSGTQEWPELSEYVLSDVTAAVAPPEPEAL
Ga0268330_10421682	3300028056	Phyllosphere	HLESVDESGTQVWSVPSLADEYILNDVTAAVAPPESEDP
Ga0268336_10126721	3300028152	Phyllosphere	MLPCEYHHLESVDESGTQVWSELSLANEYVLNDVTAAV
Ga0214492_10002473	3300032464	Switchgrass Phyllosphere	MHDLLPSEYHLLESVDENGTQVWSVLSLTDAYVLNDVTATVAPPEPEDL
Ga0214492_10841392	3300032464	Switchgrass Phyllosphere	HHLESVDVSGTQVWPEPSEYVLSDVPAAMAPPEPEDP
Ga0214488_10926722	3300032467	Switchgrass Phyllosphere	SECHHLESVDVSGTRVWPELSEYVLSDVTAAVAPPEPEDP
Ga0214489_10721251	3300032590	Switchgrass Phyllosphere	AAAVHDLLPSEYYHLESVDESRTQVWSVLSLADEYVLNDVTAAVAPPESQDP
Ga0214501_12746972	3300032625	Switchgrass Phyllosphere	VHDLFPFECHHLESVDESGTQVWPELSEYVLSDVTAAVA
Ga0314744_10737191	3300032792	Switchgrass Phyllosphere	CDAAVHDLLPSECHHLESVDVSGTQVWPELSEYVPSDVTAAVAPPVPEDP
Ga0314735_10648632	3300032824	Switchgrass Phyllosphere	CAAAVHDLLPSECHHLESVDVSGTQVWSELSEYVLSDVTAAVAP
Ga0314770_12941011	3300033533	Switchgrass Phyllosphere	VHDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAV
Ga0314759_10410812	3300033535	Switchgrass Phyllosphere	HDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL