| Basic Information | |
|---|---|
| Family ID | F094791 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 75.24 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.048 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (91.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 0.95 |
| PF10551 | MULE | 0.95 |
| PF04434 | SWIM | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.95 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.95 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.05 % |
| All Organisms | root | All Organisms | 20.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005338|Ga0068868_100798205 | Not Available | 851 | Open in IMG/M |
| 3300005614|Ga0068856_101300102 | Not Available | 742 | Open in IMG/M |
| 3300005718|Ga0068866_10678191 | Not Available | 704 | Open in IMG/M |
| 3300009176|Ga0105242_10696229 | Not Available | 994 | Open in IMG/M |
| 3300013297|Ga0157378_11223896 | Not Available | 791 | Open in IMG/M |
| 3300013297|Ga0157378_12996758 | Not Available | 524 | Open in IMG/M |
| 3300013297|Ga0157378_13301755 | Not Available | 501 | Open in IMG/M |
| 3300013308|Ga0157375_11253460 | Not Available | 871 | Open in IMG/M |
| 3300015267|Ga0182122_1061918 | Not Available | 526 | Open in IMG/M |
| 3300015268|Ga0182154_1012489 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 811 | Open in IMG/M |
| 3300015268|Ga0182154_1042111 | Not Available | 590 | Open in IMG/M |
| 3300015269|Ga0182113_1052456 | Not Available | 608 | Open in IMG/M |
| 3300015276|Ga0182170_1014940 | Not Available | 795 | Open in IMG/M |
| 3300015276|Ga0182170_1020848 | Not Available | 729 | Open in IMG/M |
| 3300015276|Ga0182170_1051408 | Not Available | 568 | Open in IMG/M |
| 3300015277|Ga0182128_1059494 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 548 | Open in IMG/M |
| 3300015279|Ga0182174_1011817 | Not Available | 876 | Open in IMG/M |
| 3300015279|Ga0182174_1066194 | Not Available | 545 | Open in IMG/M |
| 3300015279|Ga0182174_1078380 | Not Available | 517 | Open in IMG/M |
| 3300015281|Ga0182160_1049286 | Not Available | 588 | Open in IMG/M |
| 3300015283|Ga0182156_1063168 | Not Available | 556 | Open in IMG/M |
| 3300015285|Ga0182186_1028549 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 685 | Open in IMG/M |
| 3300015286|Ga0182176_1074690 | Not Available | 525 | Open in IMG/M |
| 3300015286|Ga0182176_1075189 | Not Available | 524 | Open in IMG/M |
| 3300015288|Ga0182173_1046428 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 604 | Open in IMG/M |
| 3300015289|Ga0182138_1077274 | Not Available | 526 | Open in IMG/M |
| 3300015294|Ga0182126_1009686 | Not Available | 964 | Open in IMG/M |
| 3300015295|Ga0182175_1063300 | Not Available | 576 | Open in IMG/M |
| 3300015296|Ga0182157_1079528 | Not Available | 545 | Open in IMG/M |
| 3300015300|Ga0182108_1012725 | Not Available | 936 | Open in IMG/M |
| 3300015300|Ga0182108_1061340 | Not Available | 597 | Open in IMG/M |
| 3300015305|Ga0182158_1099927 | Not Available | 510 | Open in IMG/M |
| 3300015308|Ga0182142_1107459 | Not Available | 514 | Open in IMG/M |
| 3300015314|Ga0182140_1040681 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 691 | Open in IMG/M |
| 3300015321|Ga0182127_1011908 | Not Available | 1011 | Open in IMG/M |
| 3300015321|Ga0182127_1091540 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300015322|Ga0182110_1080966 | Not Available | 577 | Open in IMG/M |
| 3300015322|Ga0182110_1113049 | Not Available | 518 | Open in IMG/M |
| 3300015323|Ga0182129_1026086 | Not Available | 783 | Open in IMG/M |
| 3300015341|Ga0182187_1039723 | Not Available | 882 | Open in IMG/M |
| 3300015341|Ga0182187_1049419 | Not Available | 820 | Open in IMG/M |
| 3300015342|Ga0182109_1042665 | Not Available | 918 | Open in IMG/M |
| 3300015343|Ga0182155_1042677 | Not Available | 905 | Open in IMG/M |
| 3300015343|Ga0182155_1192680 | Not Available | 533 | Open in IMG/M |
| 3300015344|Ga0182189_1211182 | Not Available | 518 | Open in IMG/M |
| 3300015346|Ga0182139_1177585 | Not Available | 571 | Open in IMG/M |
| 3300015346|Ga0182139_1221034 | Not Available | 523 | Open in IMG/M |
| 3300015347|Ga0182177_1088794 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 743 | Open in IMG/M |
| 3300015347|Ga0182177_1090550 | Not Available | 738 | Open in IMG/M |
| 3300015347|Ga0182177_1107021 | Not Available | 694 | Open in IMG/M |
| 3300015347|Ga0182177_1137072 | Not Available | 633 | Open in IMG/M |
| 3300015351|Ga0182161_1066345 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 865 | Open in IMG/M |
| 3300015351|Ga0182161_1105986 | Not Available | 724 | Open in IMG/M |
| 3300015351|Ga0182161_1154224 | Not Available | 627 | Open in IMG/M |
| 3300015351|Ga0182161_1243577 | Not Available | 522 | Open in IMG/M |
| 3300015351|Ga0182161_1250152 | Not Available | 516 | Open in IMG/M |
| 3300015355|Ga0182159_1042851 | Not Available | 1190 | Open in IMG/M |
| 3300015355|Ga0182159_1044788 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1171 | Open in IMG/M |
| 3300015355|Ga0182159_1189018 | Not Available | 658 | Open in IMG/M |
| 3300015355|Ga0182159_1298224 | Not Available | 540 | Open in IMG/M |
| 3300015355|Ga0182159_1326646 | Not Available | 519 | Open in IMG/M |
| 3300015361|Ga0182145_1076892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 687 | Open in IMG/M |
| 3300015361|Ga0182145_1161596 | Not Available | 535 | Open in IMG/M |
| 3300015361|Ga0182145_1162099 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 534 | Open in IMG/M |
| 3300017404|Ga0182203_1007387 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1280 | Open in IMG/M |
| 3300017404|Ga0182203_1061989 | Not Available | 689 | Open in IMG/M |
| 3300017407|Ga0182220_1044776 | Not Available | 644 | Open in IMG/M |
| 3300017407|Ga0182220_1080110 | Not Available | 549 | Open in IMG/M |
| 3300017410|Ga0182207_1038731 | Not Available | 826 | Open in IMG/M |
| 3300017410|Ga0182207_1076713 | Not Available | 665 | Open in IMG/M |
| 3300017410|Ga0182207_1147518 | Not Available | 535 | Open in IMG/M |
| 3300017413|Ga0182222_1074494 | Not Available | 555 | Open in IMG/M |
| 3300017415|Ga0182202_1057015 | Not Available | 669 | Open in IMG/M |
| 3300017417|Ga0182230_1070368 | Not Available | 625 | Open in IMG/M |
| 3300017420|Ga0182228_1083652 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 589 | Open in IMG/M |
| 3300017420|Ga0182228_1099083 | Not Available | 554 | Open in IMG/M |
| 3300017425|Ga0182224_1000180 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 3632 | Open in IMG/M |
| 3300017425|Ga0182224_1020543 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 954 | Open in IMG/M |
| 3300017425|Ga0182224_1103054 | Not Available | 587 | Open in IMG/M |
| 3300017425|Ga0182224_1120095 | Not Available | 559 | Open in IMG/M |
| 3300017425|Ga0182224_1152898 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 516 | Open in IMG/M |
| 3300017425|Ga0182224_1164130 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 503 | Open in IMG/M |
| 3300017427|Ga0182190_1009123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1295 | Open in IMG/M |
| 3300017427|Ga0182190_1023063 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 969 | Open in IMG/M |
| 3300017433|Ga0182206_1022530 | Not Available | 923 | Open in IMG/M |
| 3300017433|Ga0182206_1070183 | Not Available | 653 | Open in IMG/M |
| 3300017433|Ga0182206_1112631 | Not Available | 562 | Open in IMG/M |
| 3300017436|Ga0182209_1030316 | Not Available | 869 | Open in IMG/M |
| 3300017436|Ga0182209_1060612 | Not Available | 704 | Open in IMG/M |
| 3300017436|Ga0182209_1162943 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 513 | Open in IMG/M |
| 3300017438|Ga0182191_1093775 | Not Available | 630 | Open in IMG/M |
| 3300017438|Ga0182191_1137704 | Not Available | 554 | Open in IMG/M |
| 3300017443|Ga0182193_1004707 | Not Available | 1568 | Open in IMG/M |
| 3300017683|Ga0182218_1079019 | Not Available | 618 | Open in IMG/M |
| 3300017683|Ga0182218_1091259 | Not Available | 591 | Open in IMG/M |
| 3300017683|Ga0182218_1093326 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 587 | Open in IMG/M |
| 3300017684|Ga0182225_1093871 | Not Available | 575 | Open in IMG/M |
| 3300017690|Ga0182223_1038496 | Not Available | 694 | Open in IMG/M |
| 3300017690|Ga0182223_1046337 | Not Available | 660 | Open in IMG/M |
| 3300017690|Ga0182223_1070938 | Not Available | 588 | Open in IMG/M |
| 3300017690|Ga0182223_1093978 | Not Available | 544 | Open in IMG/M |
| 3300017690|Ga0182223_1111126 | Not Available | 519 | Open in IMG/M |
| 3300025960|Ga0207651_10796260 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 838 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 91.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068868_1007982051 | 3300005338 | Miscanthus Rhizosphere | VTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT* |
| Ga0068856_1013001021 | 3300005614 | Corn Rhizosphere | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0068866_106781912 | 3300005718 | Miscanthus Rhizosphere | MMVTAKLITILAGMEVGLKSFAISRTIGLYGLKFAKSFALTDDFLT* |
| Ga0105242_106962291 | 3300009176 | Miscanthus Rhizosphere | YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVKSSALVDDFLT* |
| Ga0157378_112238961 | 3300013297 | Miscanthus Rhizosphere | TILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0157378_129967581 | 3300013297 | Miscanthus Rhizosphere | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSAMADDFLT* |
| Ga0157378_133017551 | 3300013297 | Miscanthus Rhizosphere | VMVTAKLITILAGMEVGLKSFVISWTTELYGLKFAKLSALANDFLT* |
| Ga0157375_112534601 | 3300013308 | Miscanthus Rhizosphere | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALADDFLT |
| Ga0182122_10619181 | 3300015267 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLLNFI* |
| Ga0182154_10124892 | 3300015268 | Miscanthus Phyllosphere | AKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALADDFPT* |
| Ga0182154_10421111 | 3300015268 | Miscanthus Phyllosphere | AKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSSVLADDFLT* |
| Ga0182113_10524561 | 3300015269 | Miscanthus Phyllosphere | VTAKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALTDDFLT* |
| Ga0182170_10149401 | 3300015276 | Miscanthus Phyllosphere | LAGMEVVLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182170_10208481 | 3300015276 | Miscanthus Phyllosphere | TILAGMEVGLKSFMISRTTGLYRLKFAKSSALEDDFLT* |
| Ga0182170_10514082 | 3300015276 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182128_10594941 | 3300015277 | Miscanthus Phyllosphere | VTAKLITIMAGTQVGLKSFAISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182174_10118171 | 3300015279 | Miscanthus Phyllosphere | MVTAKLITILARMEVGLKSFVISRTIGLYGLKFAKSSALAGDFLT* |
| Ga0182174_10661941 | 3300015279 | Miscanthus Phyllosphere | MLTAKLITILAGMEVGLKSFVISRTTGLYGLKFDKSSALADDFLT* |
| Ga0182174_10783801 | 3300015279 | Miscanthus Phyllosphere | ITIMAGTRVGLKSFVISWTTGLYGLKFTKSSALAGDFLT* |
| Ga0182160_10492861 | 3300015281 | Miscanthus Phyllosphere | YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALMDDSLT* |
| Ga0182156_10631681 | 3300015283 | Miscanthus Phyllosphere | TILAGMEVGLKSFVISWTNRLYGLKFAESSALTDDFLT* |
| Ga0182186_10285491 | 3300015285 | Miscanthus Phyllosphere | VTVTAKLITILAGIEVGLKSFVISRTTGLYGLKFAKSSTLADDFLT* |
| Ga0182176_10746901 | 3300015286 | Miscanthus Phyllosphere | YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLT* |
| Ga0182176_10751891 | 3300015286 | Miscanthus Phyllosphere | LAGMEVGLKSFMISRTTGLYGLKFAQSSALADDFLT* |
| Ga0182173_10464281 | 3300015288 | Miscanthus Phyllosphere | ILAGMEVGLKSFVISWTTGLYGLKFAKSSALANDFLT* |
| Ga0182138_10772741 | 3300015289 | Miscanthus Phyllosphere | TIMAGTRVGLKSVVISRTTGLYGLKFVQSSALMDDSLT* |
| Ga0182125_10219423 | 3300015291 | Miscanthus Phyllosphere | TILAGMEFGLKSFVISWTTGLYGLKFAKLSALADDFLT* |
| Ga0182126_10096861 | 3300015294 | Miscanthus Phyllosphere | VMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALVDDFLT* |
| Ga0182175_10633001 | 3300015295 | Miscanthus Phyllosphere | AAKLITIMAGTRVGLKSFVISQTTGLYGLKFVQSFALVDDSLT* |
| Ga0182157_10795281 | 3300015296 | Miscanthus Phyllosphere | GTRVGLKSLAISRTSGLYGLKFAKSSALVDGFLT* |
| Ga0182108_10127251 | 3300015300 | Miscanthus Phyllosphere | YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALTNDFLT* |
| Ga0182108_10613401 | 3300015300 | Miscanthus Phyllosphere | TIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLT* |
| Ga0182158_10999271 | 3300015305 | Miscanthus Phyllosphere | AGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT* |
| Ga0182142_11074591 | 3300015308 | Miscanthus Phyllosphere | TAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALADDFLI* |
| Ga0182140_10406812 | 3300015314 | Miscanthus Phyllosphere | VMVTAKLITILAGMEVGLKSFVISRTTGLYRLKFAKSSALADDFLT* |
| Ga0182127_10119081 | 3300015321 | Miscanthus Phyllosphere | MVTAKLIMILAGMEVGLKSFVISWTTGLYELKFAQSSALADDFLT* |
| Ga0182127_10915402 | 3300015321 | Miscanthus Phyllosphere | MVTAKLITILARMEVGLKSFMISRTTGLYGLKFAKSSALAGDFLT* |
| Ga0182110_10809662 | 3300015322 | Miscanthus Phyllosphere | TIMAGTRVGLKSFVISRTTGLYGLKFAKSSALANDFLT* |
| Ga0182110_11130491 | 3300015322 | Miscanthus Phyllosphere | TILAGMEVGLKSFVISRTTGLYGLKFAKSSVLADDFLT* |
| Ga0182129_10260863 | 3300015323 | Miscanthus Phyllosphere | LAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182187_10397231 | 3300015341 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFVISQTIGLYGLKFTKSSALADDFLI* |
| Ga0182187_10494192 | 3300015341 | Miscanthus Phyllosphere | MQTFMYYVMVTAKLITILAGMEVGLKSFMISQTTGLYGLKFAKSSALADDFLT* |
| Ga0182109_10426651 | 3300015342 | Miscanthus Phyllosphere | KLITIMAGTRVGLKSFAISRTTGLYGLKFARSSALVDDFLT* |
| Ga0182155_10426771 | 3300015343 | Miscanthus Phyllosphere | MVTAKLIMILAGMEVGLKSFVISRTIGLYGLKFAKSSALADDFLT* |
| Ga0182155_11926802 | 3300015343 | Miscanthus Phyllosphere | AGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLLNFI* |
| Ga0182189_12111822 | 3300015344 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFVKSSALADDFLT* |
| Ga0182139_11775851 | 3300015346 | Miscanthus Phyllosphere | MVTAKLITILAGIEIGLKSFVILRTTGLYGLKFAKSSALADDFLT* |
| Ga0182139_12210341 | 3300015346 | Miscanthus Phyllosphere | MVTAKLITILAGIEVGLKSFVISRTTGLYGLKFAKSSAPANDFLT* |
| Ga0182177_10887941 | 3300015347 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFVISWTIGLYGLKFAKLSALANDFLT* |
| Ga0182177_10905502 | 3300015347 | Miscanthus Phyllosphere | VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFIQSSALVDDSLT* |
| Ga0182177_11070212 | 3300015347 | Miscanthus Phyllosphere | VMVTAKLITILAGMEIGLKSFVISRTTGLYGLKFAKSFARADDFLT* |
| Ga0182177_11370722 | 3300015347 | Miscanthus Phyllosphere | VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSPALMDDFLT* |
| Ga0182161_10663451 | 3300015351 | Miscanthus Phyllosphere | ILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT* |
| Ga0182161_11059861 | 3300015351 | Miscanthus Phyllosphere | AKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182161_11542241 | 3300015351 | Miscanthus Phyllosphere | AKLIMILARMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT* |
| Ga0182161_12435771 | 3300015351 | Miscanthus Phyllosphere | TAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLLNFV* |
| Ga0182161_12501521 | 3300015351 | Miscanthus Phyllosphere | ITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182159_10428513 | 3300015355 | Miscanthus Phyllosphere | VLVTAKLITILAGMEVGLKSFVILRTTGLYGLKFAQSSALADDFLT* |
| Ga0182159_10447881 | 3300015355 | Miscanthus Phyllosphere | TILAGMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT* |
| Ga0182159_11890181 | 3300015355 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFVISRTIGLYGLKFAKSSALVDDFLT* |
| Ga0182159_12982241 | 3300015355 | Miscanthus Phyllosphere | LITIMAGTRVGLKSFVISRTTGLYGLKFAKSSALAGDFLT* |
| Ga0182159_13266461 | 3300015355 | Miscanthus Phyllosphere | MVTAKLITILAKMEVGLKSFVISQTIGLYGLKFTKSSALADDFLI* |
| Ga0182145_10768923 | 3300015361 | Miscanthus Phyllosphere | LITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLS* |
| Ga0182145_11615961 | 3300015361 | Miscanthus Phyllosphere | AGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT* |
| Ga0182145_11620992 | 3300015361 | Miscanthus Phyllosphere | GMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT* |
| Ga0182203_10073873 | 3300017404 | Miscanthus Phyllosphere | ITIMAGTRVGLKSFVISWTTGLYGLKFVKSSTLVDDFLT |
| Ga0182203_10619891 | 3300017404 | Miscanthus Phyllosphere | ILAGMEVGLKSFVISRTIGLYGLKFAQSSALADDFLT |
| Ga0182220_10447761 | 3300017407 | Miscanthus Phyllosphere | MVTAKLITILAGMRVGLKSFVISRTTGLYGLKFAKSSALAGDFLT |
| Ga0182220_10801101 | 3300017407 | Miscanthus Phyllosphere | LVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDNFLT |
| Ga0182207_10387311 | 3300017410 | Miscanthus Phyllosphere | VMVTAKLITILAGMEVGLKSFVISRTIGLYGLKFAKSSALTDDFLT |
| Ga0182207_10767131 | 3300017410 | Miscanthus Phyllosphere | VTAKLITILAGMEVGLKSFAISRTTGLYRLKFAKSSALADDFLT |
| Ga0182207_11475181 | 3300017410 | Miscanthus Phyllosphere | TILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT |
| Ga0182222_10744941 | 3300017413 | Miscanthus Phyllosphere | AKLITIMAGTRVGLKSFVISWTTGLYGLKFAKSYALADDFLT |
| Ga0182202_10570152 | 3300017415 | Miscanthus Phyllosphere | VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALMDDFLT |
| Ga0182230_10703682 | 3300017417 | Miscanthus Phyllosphere | VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALVDDSLT |
| Ga0182228_10836522 | 3300017420 | Miscanthus Phyllosphere | ITIMAGTRVGLKSFAISRTTGLYGLKFVKSSALADDFLT |
| Ga0182228_10990831 | 3300017420 | Miscanthus Phyllosphere | ANLITILAKLLCNRLKSFMISQTTGLYGLKFAKLSDLAGDSIFNFV |
| Ga0182224_10001801 | 3300017425 | Miscanthus Phyllosphere | YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSAPADDFLT |
| Ga0182224_10205433 | 3300017425 | Miscanthus Phyllosphere | MVTAKLITIFAGIEVGLKSFVISRTTGLYGLKLAKSSALADDFLT |
| Ga0182224_11030541 | 3300017425 | Miscanthus Phyllosphere | TILAGMEVGLKSFVISRTTGLYGVKFAQSSALADDFLT |
| Ga0182224_11200952 | 3300017425 | Miscanthus Phyllosphere | YVMVTAKLITILAGMEVGLKSFVISLTTGLYWLKFAKSSARADDFLT |
| Ga0182224_11528981 | 3300017425 | Miscanthus Phyllosphere | AKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSPLADDFLT |
| Ga0182224_11641302 | 3300017425 | Miscanthus Phyllosphere | AGMEVGLKSFAISRTTGLYGLKFAKSSALADDFLT |
| Ga0182190_10091232 | 3300017427 | Miscanthus Phyllosphere | VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALMDDFLT |
| Ga0182190_10230633 | 3300017427 | Miscanthus Phyllosphere | AGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT |
| Ga0182206_10225301 | 3300017433 | Miscanthus Phyllosphere | YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT |
| Ga0182206_10701831 | 3300017433 | Miscanthus Phyllosphere | KLITILAGMEVGLKSFVISRTTGLYGLKFPKSSALVNDFLT |
| Ga0182206_11126312 | 3300017433 | Miscanthus Phyllosphere | AKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSGLADDFLT |
| Ga0182209_10303161 | 3300017436 | Miscanthus Phyllosphere | VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALVNDSLT |
| Ga0182209_10606121 | 3300017436 | Miscanthus Phyllosphere | TIMAGTRVGLKSVVISRTIGLYGLKFVKLSASVEDFLT |
| Ga0182209_11629431 | 3300017436 | Miscanthus Phyllosphere | VMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALTDDFLT |
| Ga0182191_10937751 | 3300017438 | Miscanthus Phyllosphere | MVTAKLITILAGMEVGLKSFMISRTTGLYGLKFAESSALADDFLT |
| Ga0182191_11377041 | 3300017438 | Miscanthus Phyllosphere | MVTAKLIMILAGMEVGLTSFVISQTTGLYGLKFAKSSALADGFLT |
| Ga0182193_10047071 | 3300017443 | Miscanthus Phyllosphere | AKLITILAGMEVGLKSFVISRTTGLYELKFAQSSALANDFLT |
| Ga0182218_10790192 | 3300017683 | Miscanthus Phyllosphere | VTTKLITILAGMEIGLKSFVISRTTGLYGLKFAKSSARTDDFLT |
| Ga0182218_10912591 | 3300017683 | Miscanthus Phyllosphere | YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALSDDFLT |
| Ga0182218_10933261 | 3300017683 | Miscanthus Phyllosphere | AGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT |
| Ga0182225_10938711 | 3300017684 | Miscanthus Phyllosphere | YVMVTTKLITILAGMEVGLKSFVISRTIGLYGLKFAQSSALADDFLT |
| Ga0182225_11420571 | 3300017684 | Miscanthus Phyllosphere | ILAGMEVGLKSFVISWTTGLYGLKFAKLSALADDFLT |
| Ga0182223_10384961 | 3300017690 | Miscanthus Phyllosphere | YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALIDDFLT |
| Ga0182223_10463371 | 3300017690 | Miscanthus Phyllosphere | ILAGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT |
| Ga0182223_10709382 | 3300017690 | Miscanthus Phyllosphere | VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVKSSALVDDFLT |
| Ga0182223_10939782 | 3300017690 | Miscanthus Phyllosphere | MVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSSALVDDFLT |
| Ga0182223_11111261 | 3300017690 | Miscanthus Phyllosphere | VGMEVGLKSFVISRTTGLYGLKFAKSSALSDDFLT |
| Ga0207651_107962602 | 3300025960 | Switchgrass Rhizosphere | MVAAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALVDDFLT |
| ⦗Top⦘ |