Metagenome Family F094651

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094651
Family Type	Metagenome
Number of Sequences	105
Average Sequence Length	41 residues
Representative Sequence	GFGDNDHAIRELMRFIEMTSREFIFEDATRNGGAPNYKC
Number of Associated Samples	57
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.02 %
% of genes near scaffold ends (potentially truncated)	78.10 %
% of genes from short scaffolds (< 2000 bps)	94.29 %
Associated GOLD sequencing projects	57
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (92.381 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.238 % of family members)
Environment Ontology (ENVO)	Unclassified (96.190 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (96.190 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF00078	RVT_1	0.95
PF03108	DBD_Tnp_Mut	0.95
PF13966	zf-RVT	0.95
PF00098	zf-CCHC	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
All Organisms	root	All Organisms	7.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
cellular organisms	root	All Organisms → cellular organisms	7.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.67 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6.67 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	6.67 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6.67 %
Yersiniaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	4.76 %
Serratia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4.76 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	2.86 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2.86 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.95 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.95 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.95 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.95 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.95 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.95 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.95 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.95 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.38 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.95 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.95 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101109116	Not Available	693	Open in IMG/M
3300013296\|Ga0157374_12040257	Not Available	600	Open in IMG/M
3300013297\|Ga0157378_11512571	Not Available	716	Open in IMG/M
3300014745\|Ga0157377_11379191	Not Available	555	Open in IMG/M
3300015267\|Ga0182122_1058507	Not Available	534	Open in IMG/M
3300015268\|Ga0182154_1045991	Not Available	576	Open in IMG/M
3300015269\|Ga0182113_1045007	Not Available	635	Open in IMG/M
3300015269\|Ga0182113_1048541	Not Available	622	Open in IMG/M
3300015274\|Ga0182188_1031207	Not Available	603	Open in IMG/M
3300015277\|Ga0182128_1053772	Not Available	564	Open in IMG/M
3300015282\|Ga0182124_1028006	Not Available	683	Open in IMG/M
3300015282\|Ga0182124_1039621	Not Available	622	Open in IMG/M
3300015283\|Ga0182156_1026198	Not Available	714	Open in IMG/M
3300015283\|Ga0182156_1086462	Not Available	505	Open in IMG/M
3300015285\|Ga0182186_1070621	Not Available	528	Open in IMG/M
3300015287\|Ga0182171_1043471	Not Available	620	Open in IMG/M
3300015288\|Ga0182173_1063394	Not Available	552	Open in IMG/M
3300015289\|Ga0182138_1045845	Not Available	612	Open in IMG/M
3300015289\|Ga0182138_1066640	Not Available	549	Open in IMG/M
3300015289\|Ga0182138_1081113	Not Available	518	Open in IMG/M
3300015294\|Ga0182126_1057072	Not Available	588	Open in IMG/M
3300015295\|Ga0182175_1041223	Not Available	652	Open in IMG/M
3300015298\|Ga0182106_1080929	Not Available	542	Open in IMG/M
3300015300\|Ga0182108_1055288	Not Available	616	Open in IMG/M
3300015302\|Ga0182143_1045755	Not Available	645	Open in IMG/M
3300015302\|Ga0182143_1057126	Not Available	605	Open in IMG/M
3300015303\|Ga0182123_1019211	Not Available	797	Open in IMG/M
3300015303\|Ga0182123_1032474	Not Available	691	Open in IMG/M
3300015303\|Ga0182123_1078563	Not Available	539	Open in IMG/M
3300015304\|Ga0182112_1097973	Not Available	515	Open in IMG/M
3300015304\|Ga0182112_1104558	Not Available	504	Open in IMG/M
3300015305\|Ga0182158_1013618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	902	Open in IMG/M
3300015305\|Ga0182158_1029903	Not Available	727	Open in IMG/M
3300015307\|Ga0182144_1066090	Not Available	587	Open in IMG/M
3300015313\|Ga0182164_1128959	Not Available	515	Open in IMG/M
3300015321\|Ga0182127_1015211	Not Available	944	Open in IMG/M
3300015322\|Ga0182110_1052228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	659	Open in IMG/M
3300015323\|Ga0182129_1001820	Not Available	1618	Open in IMG/M
3300015323\|Ga0182129_1014343	Not Available	929	Open in IMG/M
3300015323\|Ga0182129_1028973	Not Available	759	Open in IMG/M
3300015323\|Ga0182129_1099606	Not Available	527	Open in IMG/M
3300015323\|Ga0182129_1116442	Not Available	502	Open in IMG/M
3300015341\|Ga0182187_1106655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	631	Open in IMG/M
3300015341\|Ga0182187_1158538	Not Available	548	Open in IMG/M
3300015341\|Ga0182187_1170454	Not Available	534	Open in IMG/M
3300015342\|Ga0182109_1072489	Not Available	763	Open in IMG/M
3300015342\|Ga0182109_1160951	Not Available	570	Open in IMG/M
3300015342\|Ga0182109_1207882	Not Available	516	Open in IMG/M
3300015343\|Ga0182155_1145065	Not Available	592	Open in IMG/M
3300015343\|Ga0182155_1148413	Not Available	587	Open in IMG/M
3300015343\|Ga0182155_1190048	Not Available	536	Open in IMG/M
3300015344\|Ga0182189_1136508	Not Available	612	Open in IMG/M
3300015344\|Ga0182189_1177682	Not Available	554	Open in IMG/M
3300015344\|Ga0182189_1204113	Not Available	525	Open in IMG/M
3300015345\|Ga0182111_1126943	Not Available	648	Open in IMG/M
3300015345\|Ga0182111_1136774	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	630	Open in IMG/M
3300015345\|Ga0182111_1152352	Not Available	605	Open in IMG/M
3300015345\|Ga0182111_1181530	Not Available	565	Open in IMG/M
3300015346\|Ga0182139_1070739	Not Available	805	Open in IMG/M
3300015346\|Ga0182139_1204176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	540	Open in IMG/M
3300015347\|Ga0182177_1122267	Not Available	660	Open in IMG/M
3300015347\|Ga0182177_1127669	Not Available	650	Open in IMG/M
3300015347\|Ga0182177_1151364	Not Available	610	Open in IMG/M
3300015351\|Ga0182161_1072040	Not Available	839	Open in IMG/M
3300015351\|Ga0182161_1183738	Not Available	585	Open in IMG/M
3300015355\|Ga0182159_1086019	Not Available	912	Open in IMG/M
3300015355\|Ga0182159_1268989	Not Available	565	Open in IMG/M
3300015361\|Ga0182145_1187954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	508	Open in IMG/M
3300017404\|Ga0182203_1027727	Not Available	878	Open in IMG/M
3300017407\|Ga0182220_1036502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	681	Open in IMG/M
3300017407\|Ga0182220_1044078	Not Available	647	Open in IMG/M
3300017407\|Ga0182220_1106788	Not Available	504	Open in IMG/M
3300017410\|Ga0182207_1071955	Not Available	679	Open in IMG/M
3300017410\|Ga0182207_1101195	Not Available	608	Open in IMG/M
3300017411\|Ga0182208_1097022	Not Available	551	Open in IMG/M
3300017415\|Ga0182202_1047855	Not Available	705	Open in IMG/M
3300017424\|Ga0182219_1030765	Not Available	806	Open in IMG/M
3300017424\|Ga0182219_1106965	Not Available	548	Open in IMG/M
3300017424\|Ga0182219_1115911	Not Available	534	Open in IMG/M
3300017425\|Ga0182224_1069315	Not Available	664	Open in IMG/M
3300017425\|Ga0182224_1090669	Not Available	611	Open in IMG/M
3300017425\|Ga0182224_1115862	Not Available	565	Open in IMG/M
3300017430\|Ga0182192_1079063	Not Available	660	Open in IMG/M
3300017433\|Ga0182206_1104390	Not Available	576	Open in IMG/M
3300017433\|Ga0182206_1108854	Not Available	569	Open in IMG/M
3300017433\|Ga0182206_1120006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	551	Open in IMG/M
3300017433\|Ga0182206_1146654	Not Available	516	Open in IMG/M
3300017436\|Ga0182209_1115644	Not Available	575	Open in IMG/M
3300017436\|Ga0182209_1142436	Not Available	537	Open in IMG/M
3300017443\|Ga0182193_1101506	Not Available	633	Open in IMG/M
3300017443\|Ga0182193_1113306	Not Available	610	Open in IMG/M
3300017443\|Ga0182193_1148634	Not Available	555	Open in IMG/M
3300017680\|Ga0182233_1034499	Not Available	890	Open in IMG/M
3300017680\|Ga0182233_1062305	Not Available	663	Open in IMG/M
3300017682\|Ga0182229_1102978	Not Available	508	Open in IMG/M
3300017683\|Ga0182218_1052821	Not Available	697	Open in IMG/M
3300017683\|Ga0182218_1107929	Not Available	562	Open in IMG/M
3300017684\|Ga0182225_1030667	Not Available	813	Open in IMG/M
3300017685\|Ga0182227_1090209	Not Available	587	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.86%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.86%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.86%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.95%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1011091161	3300005334	Miscanthus Rhizosphere	VGFGDNDHVIRELMRFIEMTSRKFIFEDATRNGGAPNYKYRWLQT*
Ga0157374_120402571	3300013296	Miscanthus Rhizosphere	MGFGDNDHAIRKLMRFIEMTSREFIFEDATRNGGAPNYKCRWLQIQRR
Ga0157378_115125711	3300013297	Miscanthus Rhizosphere	LIMSFDDNDHAIRELMRFIEMTSRESIFEDVTRNGGAPNYKC*
Ga0157377_113791911	3300014745	Miscanthus Rhizosphere	CNQALNVGFGDNNHAIRGLMRFIKMTSKEFRIDDAIQNGGAPNYKC*
Ga0182122_10585071	3300015267	Miscanthus Phyllosphere	VGFDDNDHAIRELMRFIEMTSKEFMFEDATRNGGAPNYKC
Ga0182154_10459911	3300015268	Miscanthus Phyllosphere	NDHAIRELMRFIEIISRESIFEDVTRNGGASNYKC*
Ga0182113_10450071	3300015269	Miscanthus Phyllosphere	VDFGDNDHTIRELMRFIEMTSREFIFEDTTRNGGAPNVKCRWLQTQKRFNI
Ga0182113_10485411	3300015269	Miscanthus Phyllosphere	VGFDDNDHAIRELMRFIEMTSREFMFEDATQNEEAPNYKCRWLHYSNDV*
Ga0182188_10312071	3300015274	Miscanthus Phyllosphere	VGFDDNDHAIRELMRFIEMTSRESIIEDVIQNGGTPRDKSLC
Ga0182128_10537721	3300015277	Miscanthus Phyllosphere	FDDNGHTIRVLMRFIEMISRESIFEDVIRNGGSPNYDC*
Ga0182174_10525001	3300015279	Miscanthus Phyllosphere	VGFGDNDHAIRELMGFIEMASREFMFKDATRNGGAPNYEC
Ga0182124_10280061	3300015282	Miscanthus Phyllosphere	LIVGFGDNNHAIRELMRFIEMTSREFMFKDATRNGGALN*
Ga0182124_10396211	3300015282	Miscanthus Phyllosphere	VGFGVNDPAIRELIRFIEMTSREFIFADATLHGGAPNYKC
Ga0182156_10261981	3300015283	Miscanthus Phyllosphere	VGFGDNDHAFRGLMRFIEMTSKEFTIEDVIQNEGAPNLQMV
Ga0182156_10864621	3300015283	Miscanthus Phyllosphere	MGFGDNNHTIRELMRFIEMTSREFMFEDATQNGGAPNYKCRWLQPQR
Ga0182186_10706211	3300015285	Miscanthus Phyllosphere	VGFGDNDHTIRELMRFIEMTNIESIFKDVTQNRGDPNYKCEWLQPQRRFKF
Ga0182171_10434712	3300015287	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIKMTNRESIFEDVIRNGGAPNYKC*
Ga0182173_10633941	3300015288	Miscanthus Phyllosphere	MGFGDNDHAIRELIRFIEMTSRRIIREDVVHNGGAPNYKR*
Ga0182138_10458452	3300015289	Miscanthus Phyllosphere	MCFGDNDHAIRELMRFIEMTSRESIFEDVTQNGGAPNYK
Ga0182138_10666402	3300015289	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIEITSRRIIREDVIHYRGAPNYKR*
Ga0182138_10811131	3300015289	Miscanthus Phyllosphere	MGFGDNDHVIRELIRFIEMISREFIFEDATLNEGAPNYKCRWL
Ga0182126_10570721	3300015294	Miscanthus Phyllosphere	VGFGENDLAIRELMRFIEMTSREFKFEDDTRNRGAPNYKYRWF
Ga0182175_10412231	3300015295	Miscanthus Phyllosphere	VSFGNNDHAIRELIRFIEMISSEFIFEDVTQNGGA
Ga0182106_10809293	3300015298	Miscanthus Phyllosphere	CNQVLIVGFGDNDHVIRELIRFIEMTSRESIIEDVIRNGGAPNYNC*
Ga0182106_11039201	3300015298	Miscanthus Phyllosphere	VGFGDNDLAIRELMRFIEMTSREFIFKDATRNGGAP
Ga0182108_10552882	3300015300	Miscanthus Phyllosphere	MCFGDNDHIIRELMRFIKMTSREFMFEDATQNGGAPNY
Ga0182143_10457551	3300015302	Miscanthus Phyllosphere	DHAIRELMRFIEMTSREFIFEDATRNGGAPNYKYRWLQT*
Ga0182143_10571262	3300015302	Miscanthus Phyllosphere	VGFDDNDHAIRELMRFIEMTSRESIFEDVTRNGGAPNYKC*
Ga0182123_10192111	3300015303	Miscanthus Phyllosphere	DHAIRELMRFIEITSRRIIREDVIHYRGAPNYKR*
Ga0182123_10324742	3300015303	Miscanthus Phyllosphere	MGFGDYDHMIRELMRFIEMTSREFMFEDATQNRGAPNYKCRWL
Ga0182123_10785631	3300015303	Miscanthus Phyllosphere	VGFGDNDHTIRELMRFIEITSREFMFEDATQNGGAPNYKY
Ga0182112_10979732	3300015304	Miscanthus Phyllosphere	IVGFGDNDHAIRELMRFIEMTSREFIFEDATRNGGAPNYKYK*
Ga0182112_11045582	3300015304	Miscanthus Phyllosphere	GFGDNDHTIRELMRFIEMTSRKFIFEDVTRNGGAPSYKC*
Ga0182158_10136181	3300015305	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIEITSREFIFEDATRNGGAPNYKC
Ga0182158_10299031	3300015305	Miscanthus Phyllosphere	MGFGDNDHTIRELMRFIEITSREFIFDDATRNGGA
Ga0182144_10660901	3300015307	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIEMTSREFIFEDATQNGGAPNYKCR
Ga0182164_11289592	3300015313	Switchgrass Phyllosphere	QALIVGFDDNEHAIRELTRFIKMISREFIFEDAIRNGGAPNYKCRWL*
Ga0182127_10152111	3300015321	Miscanthus Phyllosphere	KCNQALIVGFGDNDHVIRELMRFIEMTSREFMFEDATRNGGDPNYKCRWLQT*
Ga0182110_10522281	3300015322	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIVMTSREFIFEDATQNGGAPNYKC
Ga0182129_10018201	3300015323	Miscanthus Phyllosphere	VPIFMCNQALIVSFDDNDHTIRGLMSFIEMTSKESIFEDVIRNGGAPNYNC*
Ga0182129_10143431	3300015323	Miscanthus Phyllosphere	VGFGDNDHAIKELMRFIEMTSWEFIFEDATRNGGAPNYKCRWL
Ga0182129_10289731	3300015323	Miscanthus Phyllosphere	DNDYAIGELKRFIEMISMEFIFEDVTRNGGAPNYKC*
Ga0182129_10996061	3300015323	Miscanthus Phyllosphere	GFGDNDHAIRELMRFIEMTSREFIFEDATRNGGAPNYKC*
Ga0182129_11164421	3300015323	Miscanthus Phyllosphere	NQALIVGFGDNDHTNRELMRFIKMTSKRIIREDVIHYGGAPSYKM*
Ga0182187_11066552	3300015341	Miscanthus Phyllosphere	VGFGDNDHVIRELMRFIEMTSREFIFEDATRNGRVPNYKYRWLQTQRR
Ga0182187_11171412	3300015341	Miscanthus Phyllosphere	MGFGDDDCIIRELMKFIEITSRKSMFKDVIRKGGAPNYKC*
Ga0182187_11585381	3300015341	Miscanthus Phyllosphere	MVGFGDNDHTIRELMRFINMTSREFIFEDATRNGGAPNYKCR
Ga0182187_11704541	3300015341	Miscanthus Phyllosphere	VGFGDNDHAIRGLLRFIEMTGMESIIENVIRKVLLSLL
Ga0182109_10724893	3300015342	Miscanthus Phyllosphere	LIVGFCDDDHAIRELMRFIKMTSRESIFEDVTRNGGAPNYNC*
Ga0182109_11609511	3300015342	Miscanthus Phyllosphere	MGFGDNDHTTRGLTRFIEMTSRRFIYEDVIHNGGAPNYN
Ga0182109_12078821	3300015342	Miscanthus Phyllosphere	VCFDDNDHAIRGLMRFIEMTSRESMIEDVIRNEGAPNYKC
Ga0182155_11450651	3300015343	Miscanthus Phyllosphere	VSFCDNDHAIRELMRFIKMTSKEFMFEDATRNGGAPN
Ga0182155_11484131	3300015343	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIEMTSRESIFEDVTRNGGAPNY
Ga0182155_11900481	3300015343	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIEMTSREFMFEDATRNGGAPN
Ga0182189_11365081	3300015344	Miscanthus Phyllosphere	CNQALIVGFGDNDHTIRGLMSFIEMTSKESIFEDVIRNGGAPNYKC*
Ga0182189_11776821	3300015344	Miscanthus Phyllosphere	LIMGFGDNDHAIRELIRFIEMTSREFIFKDATRNGGAPNYKY*
Ga0182189_12041131	3300015344	Miscanthus Phyllosphere	VGFGDNDHVIGELMRFIEMTSRRIIREDVINNRGAPNYKR
Ga0182111_11269432	3300015345	Miscanthus Phyllosphere	MGFGDNDHTIRELMRFIEMKSREFMFEDATRNRGAPNYKCRW
Ga0182111_11367741	3300015345	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIEMTSREFMFEDATRNGGAPNYK
Ga0182111_11523521	3300015345	Miscanthus Phyllosphere	VGFGDNNHAIRELMRFIEMTSREFMFEDATRNGGAPNYKC
Ga0182111_11815301	3300015345	Miscanthus Phyllosphere	IVGFGDNDHAIRELMRFIEMTSRKFIFEDATRNGGAPNYKY*
Ga0182139_10707391	3300015346	Miscanthus Phyllosphere	MGFGDNDHVIRELMRFIEMTIRRIIREDVIQNGGAPNYKR*
Ga0182139_12041761	3300015346	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIEMTSRESIFEDVTQNGGAPNYKC*
Ga0182177_11222671	3300015347	Miscanthus Phyllosphere	DHANRELMRLIEMTSRRIIREDVIHNGGAPNYKR*
Ga0182177_11276691	3300015347	Miscanthus Phyllosphere	VGFGDNDHTIRELMRFIEMTSRKFIFEDATRNGGAPNYK
Ga0182177_11513641	3300015347	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIEMTSRRIIRKDVIHNGGAPNYKR*
Ga0182161_10720401	3300015351	Miscanthus Phyllosphere	VGFSENNHAIRELMRFIEMTSRRIIREDVIHNGGAPN
Ga0182161_11837381	3300015351	Miscanthus Phyllosphere	MGFGDNDHAIKELMRFIEMTSRESIFEDVTRNGGAPNYKC*
Ga0182159_10860191	3300015355	Miscanthus Phyllosphere	VGFGDNDHVIREPMRFIEMTSREFMFKDATRNEGAPNYKCRWLQTQR
Ga0182159_12689891	3300015355	Miscanthus Phyllosphere	LIVGFGDNDHAIRGLMRFIEMISRESIFEDVIRNGGYPNYDY*
Ga0182145_11879541	3300015361	Miscanthus Phyllosphere	VGFGDNDHAIRELMRFIEMTSREFIFEDATRNGGAPNYKYR
Ga0182203_10277271	3300017404	Miscanthus Phyllosphere	MGFGDNDHVIRELMRFIEMTNKEFIFKNATRNGGAPNYKCRWLQTQ
Ga0182220_10365022	3300017407	Miscanthus Phyllosphere	VGFDDNDHAIRELMRFIEMTNMESIFKDVTQNRGDPNY
Ga0182220_10440781	3300017407	Miscanthus Phyllosphere	KCNQALIVDFGNNDHTIRGLMRFIEMTSRESIFEDVIRNGGAPKYKC
Ga0182220_11067881	3300017407	Miscanthus Phyllosphere	CNQALIVSFGDNDHAIRDLMKFIEMTSMEFIFEDVTRNGGAPNYKC
Ga0182207_10719551	3300017410	Miscanthus Phyllosphere	VGFGDNDHTIRELMRFIKMTSREFIFEDATRNGGAPNYICRW
Ga0182207_11011951	3300017410	Miscanthus Phyllosphere	VGFGDNDYIIRELMRFIEMTSREFIFEDATRNGGAPNYKYR
Ga0182208_10970221	3300017411	Miscanthus Phyllosphere	VCFGDNDHVIRELMRFIKMISRESIFEDVIRNGGTPN
Ga0182208_11036221	3300017411	Miscanthus Phyllosphere	VGFGDNDLAIRELMRFIEMTSREFIFKDATRNGGAPNYKYRWLQTQ
Ga0182202_10478551	3300017415	Miscanthus Phyllosphere	VGFDDNDHAIRELIRFIEMISREFIFEDATQNGGAPNYKCRWL
Ga0182228_10618202	3300017420	Miscanthus Phyllosphere	IVGFGDNDNAIRELMRFIEMTSWKLIFEDATRNGGVPNYKCRWLQT
Ga0182219_10307651	3300017424	Miscanthus Phyllosphere	AIREIMIFIEMTSREFIFEDATQNGGAPNYKCRWLQI
Ga0182219_11069652	3300017424	Miscanthus Phyllosphere	ALFVGFGDNDHTIRELMRFIEMTSREFTIEDVIRNEGAPNHKC
Ga0182219_11159111	3300017424	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIVITSREFIFADATRNRGAPNYKCRWLQTQRR
Ga0182224_10693152	3300017425	Miscanthus Phyllosphere	NQALIVGFGDDDRAFRKLMRFIEMTSRESMFEDVIRNGGAPNYKC
Ga0182224_10906693	3300017425	Miscanthus Phyllosphere	NDHAIRGLMRFIEKTSRESIFEDVTRNGGAPNYKC
Ga0182224_11158621	3300017425	Miscanthus Phyllosphere	VGFDDNDHVIKELMRFIEITSREFIFDDATRNGGAPNYKCR
Ga0182192_10790631	3300017430	Miscanthus Phyllosphere	VGFGIDGHQIRGLMRFIEMISKESIFEDVIRNGGSPNYDCXTI
Ga0182206_11043903	3300017433	Miscanthus Phyllosphere	LKCNQALIVGFGDNDLAIRELMRFIEMTSREFIFEDATQNGGAPN
Ga0182206_11088541	3300017433	Miscanthus Phyllosphere	NDHTIRELIRFIEITSREFIFEDVTQNGGAPNYKC
Ga0182206_11200062	3300017433	Miscanthus Phyllosphere	VGFGDNDHAIRGLMRFIEMTSRESIFEDVTRNGGAP
Ga0182206_11466541	3300017433	Miscanthus Phyllosphere	VGFDDNDHVIRELMRFIEMTSREFIFEDAIRNGGAPNYKCRWLQTQRMFKFF
Ga0182209_11156441	3300017436	Miscanthus Phyllosphere	ALIMGFGDNDHAIRELMRFIEMTSRESIFKDVTRNGGAPNYKC
Ga0182209_11424361	3300017436	Miscanthus Phyllosphere	KCNQALIVGFGDNNHETRELMRFIKMTSMKFVFEDAIQYGGAPNYKYR
Ga0182221_10553851	3300017442	Miscanthus Phyllosphere	KCNQAQIMSFGDNDHAIKELMRFIELTSTKSIIDDVVRNGGAPNYKC
Ga0182193_11015061	3300017443	Miscanthus Phyllosphere	VGFGDNDHTIRELIIFIKMTSGEFIFEDATRNRGAPNYK
Ga0182193_11133061	3300017443	Miscanthus Phyllosphere	VGFGDNDHTIRELMRFIEMISRRFINEDAIHNGGAPNFKR
Ga0182193_11486341	3300017443	Miscanthus Phyllosphere	VSFGDNDHAIRELMRFIEMTSRKFMFEDAIRNEGTPNYKCRSLQTQRRF
Ga0182233_10344991	3300017680	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIEMTRRESIFEDVTRNGGAHNYKC
Ga0182233_10623052	3300017680	Miscanthus Phyllosphere	CNQALIVGFGNNDHAIREIMRFIEMTSREFIFKDVTRNGEAFNYKC
Ga0182229_11029781	3300017682	Miscanthus Phyllosphere	MGFGDNDHTIREIMRFIEMTSRESIFEDVIRNGGAPNYKR
Ga0182218_10528211	3300017683	Miscanthus Phyllosphere	VXKCNQALIVGFGDNDHAIRELMRFIEIISREIIFEDATRNGGAL
Ga0182218_11079291	3300017683	Miscanthus Phyllosphere	VGFGDNEHIIRKLIRFIEMISRKFIFEDATRNGGA
Ga0182225_10306671	3300017684	Miscanthus Phyllosphere	MGFGDNDHAIRELMRFIKMTNRESIFEDVIRNGGAPNYKC
Ga0182227_10902091	3300017685	Miscanthus Phyllosphere	VGFGDDDYAIRELMRFIEMTSRESIIEDVIRNGGAP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094651

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences