| Basic Information | |
|---|---|
| Family ID | F094511 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DNEEIRPLSANRNTIKAMERRGLISPGKGRDPLTIVWRLKKKQP |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 88.68 % |
| % of genes from short scaffolds (< 2000 bps) | 82.08 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.566 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.245 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.830 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 16.67% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02586 | SRAP | 9.43 |
| PF00892 | EamA | 6.60 |
| PF00561 | Abhydrolase_1 | 2.83 |
| PF12680 | SnoaL_2 | 1.89 |
| PF14367 | DUF4411 | 1.89 |
| PF03150 | CCP_MauG | 1.89 |
| PF11154 | DUF2934 | 1.89 |
| PF12833 | HTH_18 | 1.89 |
| PF13787 | HXXEE | 0.94 |
| PF02581 | TMP-TENI | 0.94 |
| PF00239 | Resolvase | 0.94 |
| PF07494 | Reg_prop | 0.94 |
| PF00926 | DHBP_synthase | 0.94 |
| PF13533 | Biotin_lipoyl_2 | 0.94 |
| PF13424 | TPR_12 | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF00069 | Pkinase | 0.94 |
| PF03808 | Glyco_tran_WecG | 0.94 |
| PF06532 | NrsF | 0.94 |
| PF10431 | ClpB_D2-small | 0.94 |
| PF00857 | Isochorismatase | 0.94 |
| PF01047 | MarR | 0.94 |
| PF13618 | Gluconate_2-dh3 | 0.94 |
| PF10091 | Glycoamylase | 0.94 |
| PF04794 | YdjC | 0.94 |
| PF13517 | FG-GAP_3 | 0.94 |
| PF00403 | HMA | 0.94 |
| PF00589 | Phage_integrase | 0.94 |
| PF13431 | TPR_17 | 0.94 |
| PF04664 | OGFr_N | 0.94 |
| PF07885 | Ion_trans_2 | 0.94 |
| PF08486 | SpoIID | 0.94 |
| PF01636 | APH | 0.94 |
| PF02739 | 5_3_exonuc_N | 0.94 |
| PF00903 | Glyoxalase | 0.94 |
| PF11005 | DUF2844 | 0.94 |
| PF04055 | Radical_SAM | 0.94 |
| PF00343 | Phosphorylase | 0.94 |
| PF00106 | adh_short | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 9.43 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.77 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.94 |
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 0.94 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.94 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.94 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.94 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG1922 | UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.94 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.57 % |
| Unclassified | root | N/A | 9.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10038917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300001593|JGI12635J15846_10256548 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300004080|Ga0062385_10030715 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300004080|Ga0062385_11146536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300005171|Ga0066677_10247115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1012 | Open in IMG/M |
| 3300005176|Ga0066679_10663299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300005177|Ga0066690_10254230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300005179|Ga0066684_10892085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005434|Ga0070709_11650796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005436|Ga0070713_100746248 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300005436|Ga0070713_101438397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300005534|Ga0070735_10134325 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300005541|Ga0070733_10925286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300005568|Ga0066703_10318458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 939 | Open in IMG/M |
| 3300005602|Ga0070762_10035604 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300005889|Ga0075290_1069616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300005995|Ga0066790_10392973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300006050|Ga0075028_100635368 | Not Available | 637 | Open in IMG/M |
| 3300009137|Ga0066709_104189680 | Not Available | 525 | Open in IMG/M |
| 3300009643|Ga0116110_1212579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 625 | Open in IMG/M |
| 3300009665|Ga0116135_1378212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300009700|Ga0116217_10046549 | All Organisms → cellular organisms → Bacteria | 3172 | Open in IMG/M |
| 3300009700|Ga0116217_10143485 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300009759|Ga0116101_1053456 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009759|Ga0116101_1114643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300009759|Ga0116101_1151490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300010046|Ga0126384_10001448 | All Organisms → cellular organisms → Bacteria | 14098 | Open in IMG/M |
| 3300012209|Ga0137379_11421514 | Not Available | 596 | Open in IMG/M |
| 3300012209|Ga0137379_11722313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012211|Ga0137377_10875188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300012469|Ga0150984_119369252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300014156|Ga0181518_10433107 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300014164|Ga0181532_10103411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300014169|Ga0181531_10910319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300014489|Ga0182018_10607957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300014657|Ga0181522_10159704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300017933|Ga0187801_10314813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300017933|Ga0187801_10508997 | Not Available | 508 | Open in IMG/M |
| 3300017936|Ga0187821_10109696 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300017946|Ga0187879_10806930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300017996|Ga0187891_1218170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300017998|Ga0187870_1202735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 697 | Open in IMG/M |
| 3300018003|Ga0187876_1161017 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300018003|Ga0187876_1185377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300018013|Ga0187873_1252430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300018014|Ga0187860_1224955 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300018018|Ga0187886_1185013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300018022|Ga0187864_10069942 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300018022|Ga0187864_10112140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1400 | Open in IMG/M |
| 3300018024|Ga0187881_10191318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300018025|Ga0187885_10274648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300018034|Ga0187863_10264299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300018042|Ga0187871_10040836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2843 | Open in IMG/M |
| 3300018047|Ga0187859_10218474 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300020582|Ga0210395_10045732 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300020583|Ga0210401_10487571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300020583|Ga0210401_10556209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1009 | Open in IMG/M |
| 3300021180|Ga0210396_10473605 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300021181|Ga0210388_10005836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9639 | Open in IMG/M |
| 3300021181|Ga0210388_10380777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300021181|Ga0210388_11048882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300021401|Ga0210393_11265244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021403|Ga0210397_10152326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1617 | Open in IMG/M |
| 3300021404|Ga0210389_11557071 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021433|Ga0210391_10677156 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300021474|Ga0210390_10134777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2076 | Open in IMG/M |
| 3300021477|Ga0210398_10018323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6020 | Open in IMG/M |
| 3300021477|Ga0210398_10304489 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300021478|Ga0210402_11269425 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300021479|Ga0210410_11069597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300022521|Ga0224541_1009206 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300022531|Ga0242660_1063378 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300023068|Ga0224554_1060145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 958 | Open in IMG/M |
| 3300024225|Ga0224572_1016988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
| 3300025906|Ga0207699_10401500 | Not Available | 976 | Open in IMG/M |
| 3300025928|Ga0207700_10067433 | All Organisms → cellular organisms → Bacteria | 2739 | Open in IMG/M |
| 3300026530|Ga0209807_1190458 | Not Available | 734 | Open in IMG/M |
| 3300026552|Ga0209577_10480420 | Not Available | 842 | Open in IMG/M |
| 3300027071|Ga0209214_1022734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300027117|Ga0209732_1008650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300027604|Ga0208324_1045498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
| 3300027648|Ga0209420_1070131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300027853|Ga0209274_10105537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1393 | Open in IMG/M |
| 3300027854|Ga0209517_10000442 | All Organisms → cellular organisms → Bacteria | 70400 | Open in IMG/M |
| 3300027879|Ga0209169_10000831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19014 | Open in IMG/M |
| 3300028906|Ga0308309_11076931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 695 | Open in IMG/M |
| 3300029917|Ga0311326_10456352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 628 | Open in IMG/M |
| 3300029982|Ga0302277_1245102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300030007|Ga0311338_10486499 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300030057|Ga0302176_10049655 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300031028|Ga0302180_10105625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1607 | Open in IMG/M |
| 3300031708|Ga0310686_102117133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2155 | Open in IMG/M |
| 3300031708|Ga0310686_107443172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8121 | Open in IMG/M |
| 3300031708|Ga0310686_107785988 | All Organisms → cellular organisms → Bacteria | 37116 | Open in IMG/M |
| 3300031708|Ga0310686_110468973 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300031708|Ga0310686_119447055 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031715|Ga0307476_10001644 | All Organisms → cellular organisms → Bacteria | 13570 | Open in IMG/M |
| 3300031718|Ga0307474_10156693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1720 | Open in IMG/M |
| 3300031833|Ga0310917_10122005 | Not Available | 1697 | Open in IMG/M |
| 3300031910|Ga0306923_10426307 | Not Available | 1507 | Open in IMG/M |
| 3300032180|Ga0307471_100051425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3402 | Open in IMG/M |
| 3300032261|Ga0306920_100086401 | All Organisms → cellular organisms → Bacteria | 4623 | Open in IMG/M |
| 3300032805|Ga0335078_10665073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300032829|Ga0335070_11896787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300033402|Ga0326728_10539862 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 932 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_100389173 | 3300001546 | Forest Soil | KDNEEIRPLSANRNTIKALEQRGLIGPGKGREPLTIGWRLKSKIS* |
| JGI12635J15846_102565481 | 3300001593 | Forest Soil | IRPLSAIRNTIKAMERGGLITPGKGRDPLNIVWHLKKKGS* |
| Ga0062385_100307151 | 3300004080 | Bog Forest Soil | ETRPLSANRNTIKALERRGLISPGKGPDPLTIAWHLKKKQT* |
| Ga0062385_111465361 | 3300004080 | Bog Forest Soil | IRPLSANRNTIKALEGRGLISPGKGREPLTIVWRLKKKID* |
| Ga0066677_102471151 | 3300005171 | Soil | LKDNEEMRPLSANRNTIKAMEQRGLISPGNGRDSLSIVWRLKKKQP* |
| Ga0066679_106632992 | 3300005176 | Soil | RPLSANRNTIKAMERRGLISPGKGRDPLTIAWRLKKKQP* |
| Ga0066690_102542303 | 3300005177 | Soil | GNPILRRAKDDEVIRPRSANRNTIKALEERGLIRSDRGRDLLTMVWHTNKKR* |
| Ga0066684_108920851 | 3300005179 | Soil | PVLLRLKDNEEIRPLSANRNTIKAMERRGLIRPGKGRDPLTIAWRLKRKQP* |
| Ga0070709_116507961 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EEIRPLSANRNTIKAMERRGLISPSKGRDLLSIVWCLKEK* |
| Ga0070713_1007462481 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RLKDNEVIRPISANRNTIKALEERGLISPGKGRDLLTILWRLKKKQA* |
| Ga0070713_1014383972 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LEDNEEIRPLSANRNTIKAMEQRGLISPGKDRDPLTIVWRLKRKIN* |
| Ga0070735_101343251 | 3300005534 | Surface Soil | LRSLKDDQEIRALSANRSTIKAMEQRGLISPGKGPDPLIIVWRLKKKAQ* |
| Ga0070733_109252861 | 3300005541 | Surface Soil | RLKDDEVIRPLSANRNTIKALEERGLIHSGKGRDPLTMAWHTNKKR* |
| Ga0066703_103184582 | 3300005568 | Soil | NRNTIKAMERRGLISPGKGRDPLTIVWRLKKKQP* |
| Ga0070762_100356045 | 3300005602 | Soil | PLSATRNTIKAMEQRGFIVPVKGRDPLTILWRLKKKIN* |
| Ga0075290_10696162 | 3300005889 | Rice Paddy Soil | KNDEAIRPLSANRNSIKALQERALITPGKGRDPLTISWRLKKTAN* |
| Ga0066790_103929732 | 3300005995 | Soil | NPILRRLKDEEEIRPLSANRNTIKAMEDRGLISPGKGRGPLTILWRLKKRIN* |
| Ga0075028_1006353682 | 3300006050 | Watersheds | NPILRRLKDDEVVRPLSANRNTIKALEERGLIHSGKGNDPLTIVWHTNKKR* |
| Ga0066709_1041896801 | 3300009137 | Grasslands Soil | RRSKDDEGIRPLSANRNTIKAMEQRGLISPGKGRDALTIMWRLKKK* |
| Ga0116110_12125791 | 3300009643 | Peatland | IRPLSANRNTIKALEERGLISPGKGRDPLTIMWRLKKK* |
| Ga0116135_13782122 | 3300009665 | Peatland | MLRRLRQSEEKGALGASGNTIRAMERRGLIRTGKGRDPLTILWRLKKKIN* |
| Ga0116217_100465495 | 3300009700 | Peatlands Soil | EEMRPLSANRNTIKAMERRALIRPGKGRDPLTIV* |
| Ga0116217_101434854 | 3300009700 | Peatlands Soil | LRRLKDNEEIRPLSANRNTIKALEKRGLISLGKGRDPLTIVWRLKKK* |
| Ga0116101_10534561 | 3300009759 | Peatland | NEEIRPLSATRNSIKAMEQRGFISPSKGRDPLTILWCLNKK* |
| Ga0116101_11146432 | 3300009759 | Peatland | FLRRLKDNEEVRPLSANRNTVKAMEQRGLISPGKGRDLLTTLWRLKRKSP* |
| Ga0116101_11514901 | 3300009759 | Peatland | EIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKK* |
| Ga0126384_100014481 | 3300010046 | Tropical Forest Soil | QNKDRANRSTIKAMEERGLISPSKSDDPLVWRVTKKTGK* |
| Ga0137379_114215141 | 3300012209 | Vadose Zone Soil | VLRRSKNDEGIRPLSANRNTIKAMEQRGLISPGKGRDALTIVWRLNKKIK* |
| Ga0137379_117223132 | 3300012209 | Vadose Zone Soil | EIRPLSANRNTIKALERRGLINPGKGRDPLTIVWRLKKKRT* |
| Ga0137377_108751882 | 3300012211 | Vadose Zone Soil | LKDDEVIRPASANRNTIKAMEKRGLIRPAGKGRDPLTIVWHLQKKAK* |
| Ga0150984_1193692521 | 3300012469 | Avena Fatua Rhizosphere | KNDEAIRPLSANRNSIKALQERGLITPGKGRDPLTISWRLKKTSK* |
| Ga0181518_104331072 | 3300014156 | Bog | VLRRLKDNEEIRPLAANRNTIKAMEKRGLISPGKGRDPLTIVWRLKKKVNY* |
| Ga0181532_101034114 | 3300014164 | Bog | LRRLKDNEAIRPLSANRNTIKALEERGLISPGKGRDPLTIMWRLKKK* |
| Ga0181531_109103192 | 3300014169 | Bog | LKRNEEICPLSANRNTIKAMERRGLISPGKGLEALTIEWRL |
| Ga0182018_106079571 | 3300014489 | Palsa | NEEIRPLSANRNTIKAMERRGVITPGKGRDLLTIVWRLKRK* |
| Ga0181522_101597041 | 3300014657 | Bog | KDKAEIRPLSATRNTIKAMEQRGLISPEKGRDPLTLGWRLKRK* |
| Ga0182039_104751452 | 3300016422 | Soil | LKDGEVIRPLSANVSTVKALEERGLIHPGKGRDPLTIVWRLKENPM |
| Ga0187801_103148131 | 3300017933 | Freshwater Sediment | PLSANRNTIKALEQRGLISPGKSRDPLTIVWRLKKKQP |
| Ga0187801_105089971 | 3300017933 | Freshwater Sediment | SANRNTIKALEQRGLISPDKGRDPLTIVWRLKKKQP |
| Ga0187821_101096962 | 3300017936 | Freshwater Sediment | KDNEVIRPLSAKRSTIKSLEQRGLISPGKGRDPLTILWRLKKKTK |
| Ga0187879_108069301 | 3300017946 | Peatland | LGGNPILRRLKDNEEIRPLSANRNTIRAMERRGLISPGKGRDPLTILWRLKKKIN |
| Ga0187891_12181702 | 3300017996 | Peatland | ANRNTAKAMEQRGLISPGKGRDPLTIVWRLKKKIN |
| Ga0187870_12027351 | 3300017998 | Peatland | PLSANRSTIKALEQRGFINPGKGRDPLTIVWRLKKKTN |
| Ga0187876_11610173 | 3300018003 | Peatland | SANRNTIKAMEQRGLIRPGKGRDPLTIVWRLKKKIN |
| Ga0187876_11853771 | 3300018003 | Peatland | SANRNTIKALEGRGLISPGKGRDPFAIVWRLKKKID |
| Ga0187873_12524302 | 3300018013 | Peatland | GGNPVLRRLKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKK |
| Ga0187860_12249552 | 3300018014 | Peatland | VLRRLKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKK |
| Ga0187886_11850131 | 3300018018 | Peatland | ANRNTIKAMEKRGLISPGKGRDPLTIVWRLKKKVNY |
| Ga0187864_100699421 | 3300018022 | Peatland | QEIRPLSANRNTIKAMERRGLISPGKGRDPLIIVWRLKKKIN |
| Ga0187864_101121405 | 3300018022 | Peatland | NQEIRPLSANRNTIKAMERRGLISPGKGRDPLIIVWRLKKKID |
| Ga0187881_101913181 | 3300018024 | Peatland | RLKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKK |
| Ga0187885_102746482 | 3300018025 | Peatland | LKLIRSAVTPVLRRLKDNEEIRPLSANRNTIKGMERRGLITPGKGRDLLTIVWRLKKKIK |
| Ga0187863_102642991 | 3300018034 | Peatland | PVLRRLKDNEEIRPLSVNRNTVKAMEQRGLIRPSKGRDPLTIVWRLKKKIN |
| Ga0187871_100408361 | 3300018042 | Peatland | VPPLPANRNTIKAIERRGLISPDKGHDPFAIVWRLEKKAK |
| Ga0187859_102184742 | 3300018047 | Peatland | LKDNEEIRPLSANRNTIKALEKRGLISPGKGRDPLTIAWRLEKKIK |
| Ga0210395_100457324 | 3300020582 | Soil | MSASANRNTIKALEQRGLISPGKGHGPLTILWRLKRKTDQE |
| Ga0210401_104875713 | 3300020583 | Soil | VIRPLSANRNTIKALEERGLIQSGKGRDPLTMVWHANKKR |
| Ga0210401_105562091 | 3300020583 | Soil | LGGNPILRRLKDDEEIRPLSANRNTIKALERRGLIGPGKGRDPLTILWRLKRKMN |
| Ga0210396_104736053 | 3300021180 | Soil | SANRNTIKAMERRGLISPGKGRNPLTIVWRLKKKID |
| Ga0210388_100058361 | 3300021181 | Soil | LKDNEEIRALSANRNTIKAMEQRGLIIPGKGRDPLTIVWRLKKR |
| Ga0210388_103807771 | 3300021181 | Soil | ASANRNTIKALEQRGLISPGKGHGPLTILWRLKRKTDQE |
| Ga0210388_110488821 | 3300021181 | Soil | EEIRPRSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKKQP |
| Ga0210393_112652441 | 3300021401 | Soil | ALCPPIRNTIKAMERRGLITPSKGRDLLTIEWRLKKKQP |
| Ga0210397_101523262 | 3300021403 | Soil | LKDNEEMRPLSATRNTIKALEKRGLISAGKGRDPLTMVWRLKPK |
| Ga0210389_115570712 | 3300021404 | Soil | GNPVLRRLKDNEEIRALSANRNTIKAMEQRGLIVPVKGRDSLTIVWRLKKKQS |
| Ga0210391_106771562 | 3300021433 | Soil | LRHLKDNEEMRPMSANRNTIKALEQRGLISPGKGRDPLTIVWDLNERLT |
| Ga0210390_101347773 | 3300021474 | Soil | RLKDDEVIRPLSANRNTIKALEERGLIHSEKGRDPLTMAWHTNKKR |
| Ga0210398_100183236 | 3300021477 | Soil | RLKDNEEIRPRSANRNTIKAMEQRGLISPGKGRDPLAIVWRLKKKQP |
| Ga0210398_103044891 | 3300021477 | Soil | SANRNTIKAMEQRGLIIPGKGRDPLTIVWRLKKKIN |
| Ga0210402_112694251 | 3300021478 | Soil | KDNAEIRPLSANRSTTKALEQRGLISPGKGRDPLTIVWRLKNK |
| Ga0210410_110695971 | 3300021479 | Soil | PVLRQLKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWGLKKKIK |
| Ga0224541_10092061 | 3300022521 | Soil | DNEEIRPLSANRNTITAMEQRGLISPGQGRDPLTILWRLKKKQP |
| Ga0242660_10633781 | 3300022531 | Soil | LKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTVGWRLKKKIN |
| Ga0224554_10601451 | 3300023068 | Soil | EEIRPLSANRNTVKAMEQRGLISPGKGRDPLTIVWRLKKKIN |
| Ga0224572_10169881 | 3300024225 | Rhizosphere | PMSANRNTIKALEQRGLISPGKGRDPLTIVWDLNKRLM |
| Ga0207699_104015002 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RPLSANRNTIKALEESGLIHSGKGNDPLTTVWHTNKKR |
| Ga0207700_100674335 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLKDNEVIRPISANRNTIKALEERGLISPGKGRDLLTILWRLKKKQA |
| Ga0209807_11904581 | 3300026530 | Soil | DNEEIRPLSANRNTIKAMERRGLISPGKGRDPLTIVWRLKKKQP |
| Ga0209577_104804202 | 3300026552 | Soil | RRLKDNEVIRPLSANRNTIKAMEQRGLISPGKGHDPLTIAWRLKRKQP |
| Ga0209214_10227342 | 3300027071 | Forest Soil | LSANRNTIKAMERRGLISPGKDRDPLTIVWRLKRKIN |
| Ga0209732_10086503 | 3300027117 | Forest Soil | KDNEEIRPRSANRNTIKAMEQRGLISPGKGRDPLAIVWRLKKKQP |
| Ga0208324_10454982 | 3300027604 | Peatlands Soil | PVLRHLKDNEEMRPLSANRNTIKAMERRALIRPGKGRDPLTIV |
| Ga0209420_10701311 | 3300027648 | Forest Soil | LKDNEEIRPLSANRNTIKALEQRGLIGPGKGREPLTIGWRLKSKIS |
| Ga0209274_101055372 | 3300027853 | Soil | LKDNEEIRPLSANRNTIKAMERRGLISPGKGRDPLTILWRLKKKIN |
| Ga0209517_1000044260 | 3300027854 | Peatlands Soil | GDPILRRLKDNEVIRPLSANRNTIKALERRGLISPGEGRDPLTIVWRLKKKID |
| Ga0209169_100008311 | 3300027879 | Soil | NPILRRLKDNEEMRPLSANRNTIKAMEQRGLIIPGKGRDPLTIVWRLKKR |
| Ga0308309_110769312 | 3300028906 | Soil | PLSANRNTIKAMEQRGLIIPGKGRDPLTIVWRLKKDK |
| Ga0311326_104563521 | 3300029917 | Bog | SANRNTIKALERRGLISPGEGRDPLTIVWRLKKKID |
| Ga0302277_12451021 | 3300029982 | Bog | RPLSANRNTIKAMEERGLISPGKGRDPLTILWRLKKKQA |
| Ga0311338_104864993 | 3300030007 | Palsa | EEIRPLSANRSTIKTLEQRGFISPGKGRDLLTIVWRLKKKTN |
| Ga0302176_100496556 | 3300030057 | Palsa | PVLRRLKDNEEIRPLSANRNTITAMEQRGLISPGQGRDPLTILWRLKKKQP |
| Ga0302180_101056253 | 3300031028 | Palsa | LKDNEEIRPLSANRNTIKAMEERGLISPGKGRDPLTIVWRLKKKIS |
| Ga0310686_1021171332 | 3300031708 | Soil | LKDDEEIRHLSANRNTIKAMEQRGLISPGKGHEPLTIVWRLKKKMN |
| Ga0310686_1074431721 | 3300031708 | Soil | PILRRLKDNEEIRPLSANRNTIKAMEKRGLISPDKGREPLTIAWRLKKKIK |
| Ga0310686_10778598835 | 3300031708 | Soil | LKDDEEIRPLSANRRTIEALEERGLISPDKGRDPLTIVWRLKQKAK |
| Ga0310686_1104689731 | 3300031708 | Soil | MRPMSANRNTIKALEQRGLISPGKGRDPLTIVWDLNERLT |
| Ga0310686_1194470551 | 3300031708 | Soil | PVLRRLKDNEEIRPLSANRNTVKAMERRGLITPGKGRDPLTIVWRLKKKQP |
| Ga0307476_100016441 | 3300031715 | Hardwood Forest Soil | LKDNEEIRPLSANRNTVKALERRGLISPGKGRDALTIAWRLKKK |
| Ga0307474_101566933 | 3300031718 | Hardwood Forest Soil | LSANRNTIKALEERGLIHSGKGRDPLTMAWHTDKKR |
| Ga0310917_101220052 | 3300031833 | Soil | PVLLRLKDGEVIRPLSANVSTVKALEERGLIHPGKGRDPLTIVWRLKENPM |
| Ga0306923_104263071 | 3300031910 | Soil | AKASTVKALEERGLIHPGKGRDPLTIVWRLKENPM |
| Ga0307471_1000514251 | 3300032180 | Hardwood Forest Soil | EEIRPLSANRNTIKAMVQRGLISPGKGRDPLTIVWRLKKK |
| Ga0306920_1000864011 | 3300032261 | Soil | SAKASTVKALEEGGLIHPGKGRDPLTIVWRLKENPM |
| Ga0335078_106650734 | 3300032805 | Soil | IRPLSANASTVKALQERGLIHAVKGRDPLTIVWRLRKK |
| Ga0335070_118967872 | 3300032829 | Soil | KDGEVIRPLSANRNTIKALEERGLIRSGKGNDPLTIVWRANKQS |
| Ga0326728_105398623 | 3300033402 | Peat Soil | RPLSANRNTTKALEERGLISPGKGRDPLTIVWRLKKKID |
| ⦗Top⦘ |