| Basic Information | |
|---|---|
| Family ID | F094496 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKLTTGILAMAMMVGGAWAQNPDAIDTARSTAKSLQQKQA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 92.45 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (17.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.208 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF04350 | PilO | 80.19 |
| PF05137 | PilN | 16.98 |
| PF11104 | PilM_2 | 1.89 |
| PF12728 | HTH_17 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 160.38 |
| COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 33.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.11 % |
| Unclassified | root | N/A | 1.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10217490 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100303287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1481 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100510560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1079 | Open in IMG/M |
| 3300004080|Ga0062385_10074107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1565 | Open in IMG/M |
| 3300004091|Ga0062387_100163017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1300 | Open in IMG/M |
| 3300004091|Ga0062387_100499026 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300004092|Ga0062389_102811377 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300004152|Ga0062386_100907430 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004153|Ga0063455_100254071 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300004470|Ga0068967_1252201 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300004471|Ga0068965_1233299 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004473|Ga0068919_1331060 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300004475|Ga0068969_1397297 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300004477|Ga0068971_1521409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1363 | Open in IMG/M |
| 3300004605|Ga0068952_1250583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 946 | Open in IMG/M |
| 3300004615|Ga0068926_1390061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1301 | Open in IMG/M |
| 3300004616|Ga0068930_1335408 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004617|Ga0068955_1412098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1684 | Open in IMG/M |
| 3300004972|Ga0072325_1277474 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005332|Ga0066388_103533908 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005332|Ga0066388_105572724 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005435|Ga0070714_100902392 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005541|Ga0070733_10910174 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005554|Ga0066661_10663060 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005610|Ga0070763_10604577 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006162|Ga0075030_100244328 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300006162|Ga0075030_101223940 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009638|Ga0116113_1086062 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009759|Ga0116101_1000499 | All Organisms → cellular organisms → Bacteria | 4306 | Open in IMG/M |
| 3300010043|Ga0126380_11604880 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010048|Ga0126373_10318244 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300010359|Ga0126376_12503335 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010398|Ga0126383_10506399 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300010937|Ga0137776_1340118 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300010937|Ga0137776_1708706 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300011055|Ga0138550_112261 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300011060|Ga0138583_1072661 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300011061|Ga0138534_1061618 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300011065|Ga0138533_1111262 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300011067|Ga0138594_1105902 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300011076|Ga0138574_1062817 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300011084|Ga0138562_1180446 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300011088|Ga0138576_1017748 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300011120|Ga0150983_12602286 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300011269|Ga0137392_10861043 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300011270|Ga0137391_10503905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1025 | Open in IMG/M |
| 3300012096|Ga0137389_10488245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1056 | Open in IMG/M |
| 3300012199|Ga0137383_10665427 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012203|Ga0137399_11297700 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012351|Ga0137386_11137893 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012924|Ga0137413_11034825 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012957|Ga0164303_11090417 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012971|Ga0126369_10316673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1568 | Open in IMG/M |
| 3300012987|Ga0164307_10731936 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300013100|Ga0157373_10436721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 941 | Open in IMG/M |
| 3300015372|Ga0132256_103905937 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300016341|Ga0182035_12149038 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300016371|Ga0182034_10983648 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300017975|Ga0187782_10609387 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300017993|Ga0187823_10224495 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018016|Ga0187880_1469993 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018042|Ga0187871_10109946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1581 | Open in IMG/M |
| 3300018044|Ga0187890_10751627 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021170|Ga0210400_11034677 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300022507|Ga0222729_1002138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1598 | Open in IMG/M |
| 3300022507|Ga0222729_1068934 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300022509|Ga0242649_1057188 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300022533|Ga0242662_10294464 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300022726|Ga0242654_10348565 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025527|Ga0208714_1064246 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300025915|Ga0207693_10315779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1223 | Open in IMG/M |
| 3300025929|Ga0207664_10316367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1376 | Open in IMG/M |
| 3300027063|Ga0207762_1005676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2495 | Open in IMG/M |
| 3300027071|Ga0209214_1017881 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027117|Ga0209732_1019004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1162 | Open in IMG/M |
| 3300027576|Ga0209003_1112174 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027629|Ga0209422_1011238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2206 | Open in IMG/M |
| 3300027648|Ga0209420_1142715 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027727|Ga0209328_10078155 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300027783|Ga0209448_10076792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1121 | Open in IMG/M |
| 3300027795|Ga0209139_10138252 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300027857|Ga0209166_10531363 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300027867|Ga0209167_10782543 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027889|Ga0209380_10217347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1123 | Open in IMG/M |
| 3300027895|Ga0209624_10449142 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027905|Ga0209415_10402633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1104 | Open in IMG/M |
| 3300028047|Ga0209526_10619171 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300029943|Ga0311340_10029188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6792 | Open in IMG/M |
| 3300030509|Ga0302183_10361400 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300030520|Ga0311372_11445825 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300030617|Ga0311356_11127819 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300030687|Ga0302309_10087845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1689 | Open in IMG/M |
| 3300031231|Ga0170824_128017796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 990 | Open in IMG/M |
| 3300031241|Ga0265325_10260154 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031249|Ga0265339_10061662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2017 | Open in IMG/M |
| 3300031469|Ga0170819_11598287 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031716|Ga0310813_10377881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1214 | Open in IMG/M |
| 3300031754|Ga0307475_10684029 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031823|Ga0307478_10526408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 986 | Open in IMG/M |
| 3300032205|Ga0307472_100348276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1215 | Open in IMG/M |
| 3300032828|Ga0335080_10031939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5758 | Open in IMG/M |
| 3300033004|Ga0335084_11165204 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300033134|Ga0335073_11998698 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300033804|Ga0314863_086990 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 17.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.89% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.94% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004616 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011055 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_102174902 | 3300001867 | Forest Soil | MKLTTGIVAVAMMAGVAFGQSPDAIDNARSTVKALQQQQA |
| JGIcombinedJ26739_1003032874 | 3300002245 | Forest Soil | MKLITSILAIAVMAGGAWAQNPDAIDNARSVAKSLQQKQAN |
| JGIcombinedJ26739_1005105603 | 3300002245 | Forest Soil | MKLTTSILAIAVMAGAAWAQNPDAIDNARSVAKSLQQKQANDTNAAL |
| Ga0062385_100741074 | 3300004080 | Bog Forest Soil | MKTAMKLTGILAMALMVSGSAAKAAAQNTDAIDNARSIAKSLQQKQANDTNA |
| Ga0062387_1001630173 | 3300004091 | Bog Forest Soil | MKLTKSILVVAIMTGAAWAQNPDAIDNARSVAKSLQQKQANDTN |
| Ga0062387_1004990261 | 3300004091 | Bog Forest Soil | MKTAMKLTTGILAITITMTAVGTLAAAQNTDAIDNARSIAKSLQQKQAN |
| Ga0062389_1028113771 | 3300004092 | Bog Forest Soil | MKTAMKLTTGILAITITMTAVGTLAAAQNTDAIDNARSIAKSLQQKQAND |
| Ga0062386_1009074301 | 3300004152 | Bog Forest Soil | MKLTNQLTTGILAVAITVTVSGFAATQAAAQNADAIDNARSTAKSLQ |
| Ga0063455_1002540711 | 3300004153 | Soil | MKTAIKLTTGILTIAMMAGGVLAQNTDAIDQARSTAKALQQKQASDTNTTAKPAP |
| Ga0068967_12522012 | 3300004470 | Peatlands Soil | MKLTTGILAMALMVSGSSATKAVAQNPDAIDNARSIAKSLQQKQ |
| Ga0068965_12332992 | 3300004471 | Peatlands Soil | MKKAMKLNLGILAIAVTMAAGTTLAPTAAAQNPDAIDNARS |
| Ga0068919_13310602 | 3300004473 | Peatlands Soil | MKKAMKLNLGILAIAVTMAAGTTLAPTAAAQNPDAIDNARSI |
| Ga0068969_13972971 | 3300004475 | Peatlands Soil | MKLTTGILAMAITMTAGAAFSARAVAQNPDAIDNARSIAKSLQQKQANDS |
| Ga0068971_15214091 | 3300004477 | Peatlands Soil | MKKAMKLNLGILAIAVTMAAGTTLAPTAAAQNPDAIDNARSVAKSLQQKQTNDTNAA |
| Ga0068952_12505833 | 3300004605 | Peatlands Soil | MKLTTGILAMAITMTAGAAFSARAVAQNPDAIDNARSIAKSLQQKQAN |
| Ga0068926_13900611 | 3300004615 | Peatlands Soil | MKKLTTAILAVAVMAGGSAGTRAAAQNPDAIDNARSTAKSLQQK |
| Ga0068930_13354082 | 3300004616 | Peatlands Soil | MKLTTGILAITITMTAGATLAPQALAQNPDAIDNARSVAKSLQQKQ |
| Ga0068955_14120981 | 3300004617 | Peatlands Soil | MKLTNQLTTGILATAVMVGGSWAAAAAQSPDAIDNARSTAKSLQQQQA |
| Ga0072325_12774741 | 3300004972 | Peatlands Soil | MKLTTGILAMAITMTAGAAFSARAVAQNPDAIDNARSIAKSLQQKQAND |
| Ga0066388_1035339081 | 3300005332 | Tropical Forest Soil | MNTAMKRTTGILAIAILCSAAFSVKAVGQNPDAIENARSVAKSLQQKQ |
| Ga0066388_1055727242 | 3300005332 | Tropical Forest Soil | MKTAMKRTTGILAIALTMTLGAAWTTKAAAQNPDAIDNARSVAKSL |
| Ga0070714_1009023922 | 3300005435 | Agricultural Soil | MKTAMKLKTGTLAIALTMTMGAAFSTKAVAQNPDAIDNARS |
| Ga0070733_109101741 | 3300005541 | Surface Soil | MKLTTGILAITLTMASGAALVSKAAAQNTDAIDNARSVAKSLQQKQTND |
| Ga0066661_106630601 | 3300005554 | Soil | MKLTTGIVAMAMMVGGAAVAQNPDAIDNARKTVKSLQQQQAAKP |
| Ga0070763_106045771 | 3300005610 | Soil | MKTAMKLKTGTLAIALTMTMGAAFSTKAVAQNPDAIDNARSVAKSLQQKQAND |
| Ga0075030_1002443283 | 3300006162 | Watersheds | MKLTTGILAIAITMTASATLAPKALAQNPDAIDNARSIAKSLQQKQ |
| Ga0075030_1012239402 | 3300006162 | Watersheds | MKLTTGILAITITMTAGATLVPKALAQNPDAIDNARSVAKSLQQKQ |
| Ga0116113_10860622 | 3300009638 | Peatland | MKLTKQVTTGILAVAITVTAGGFAAAKAAAQTPDAIDNAR |
| Ga0116101_10004991 | 3300009759 | Peatland | MKLTTGILAVAVAMTTGVAFGQNPDAIDNARSVAKSLQQ |
| Ga0126380_116048802 | 3300010043 | Tropical Forest Soil | MKLTTVILAVATTVTAGAAFAQNPDAIDNARSVAKSLQQKQENDT |
| Ga0126373_103182444 | 3300010048 | Tropical Forest Soil | MKLTTVILATAITMTAGAAFAQNPDAIDNARSVAKSLQQKQANDS |
| Ga0126376_125033353 | 3300010359 | Tropical Forest Soil | MKTAMKRTTGILAIALTMTLGAAWTTKAAAQNPDAIDNARSVAKSLQ |
| Ga0126383_105063991 | 3300010398 | Tropical Forest Soil | MKKAMKRTTGILAIALTMTLGAAWTSKAAAQNPDAIDNARS |
| Ga0137776_13401181 | 3300010937 | Sediment | MKTAMKLTTGILATALMVGGTTALAAGQNPDAIDNARSVA |
| Ga0137776_17087062 | 3300010937 | Sediment | MKLTTSILAVTMMAGGSWAAIAAQNPDAIDNARSAAKSLQQNQANPAPK |
| Ga0138550_1122611 | 3300011055 | Peatlands Soil | MKLTNQLTTGILATAVMVGGSWAAAAAQSPDAIDNARSTAKSLQQQQ |
| Ga0138583_10726611 | 3300011060 | Peatlands Soil | MKLTIKLTFKLTTGILATAMIVGGSVAAQAQSPDAIDNARSTAKSLQQQQANPA |
| Ga0138534_10616182 | 3300011061 | Peatlands Soil | MKKAMKLNLGILAIAVTMAAGTTLAPTAAAQNPDAIDNARSVAKSLQQKQ |
| Ga0138533_11112621 | 3300011065 | Peatlands Soil | MKLTIGILVMAITMTAGAASAQNTDAIDNARSVAKSLQQKQEIDTNAAL |
| Ga0138594_11059024 | 3300011067 | Peatlands Soil | MKKAMKLNLGILAIAVTMAAGTTLAPTAAAQNPDAIDNARSVAKSLQQKQTN |
| Ga0138574_10628172 | 3300011076 | Peatlands Soil | MKLTNQLTTGILATAVMVGGSWAAAAAQSPDAIDNARSTAKSLQ |
| Ga0138562_11804463 | 3300011084 | Peatlands Soil | MKLTIGILVMAITMTAGAASAQNTDAIDNARSVAKSLQQKQEID |
| Ga0138576_10177482 | 3300011088 | Peatlands Soil | MKLTTGILAMAMMVGGAWAQNPDAIDTARSTAKSLQQKQAND |
| Ga0150983_126022863 | 3300011120 | Forest Soil | MKLTNQLTTGILAVAITMTAGGFAAQRAAAQTPDAIDNARSTEKSLQQQANNS |
| Ga0137392_108610432 | 3300011269 | Vadose Zone Soil | MKLTTGILAIAIMASGSAATKAMAQNPDAIDNARSTAKSLQQKQDN |
| Ga0137391_105039051 | 3300011270 | Vadose Zone Soil | MKLTTGILAVVMMTGAAWGQNPDAIDNARSVAKSLQQIKANETNAALDAA |
| Ga0137389_104882451 | 3300012096 | Vadose Zone Soil | MKLTTGILAVAIVAMAGGAWAQNPDAIDNARSVAKSLQQKQ |
| Ga0137383_106654272 | 3300012199 | Vadose Zone Soil | MKLTIRLTTGILAMAMVVGGSAATTAVAQNADAIDNARSTAKSLQQKQDNAAS |
| Ga0137399_112977002 | 3300012203 | Vadose Zone Soil | MKLTTGILVMAMMAGGAWAQNPKAIDNAALKAAGV |
| Ga0137386_111378932 | 3300012351 | Vadose Zone Soil | MKLTIGVLASAMMVSGAWAQNPDAIDNARSTAKSLQQKQD |
| Ga0137413_110348251 | 3300012924 | Vadose Zone Soil | MKLTIRLTTGILAMALVVSGSAATTAVAQNADAIDNARST |
| Ga0164303_110904172 | 3300012957 | Soil | MKKAMKRTTGILAIALTMTLGAAWTSKAAAQNPDAIDNARSVAKSLQQKQA |
| Ga0126369_103166731 | 3300012971 | Tropical Forest Soil | MKTAMKLTTGILATALMMGAALSAKSWGQNPDAIDNARSVAKSLQQKQ |
| Ga0164307_107319362 | 3300012987 | Soil | MKLTTGIVALAMMVGGAAVAQNPDAIDNARKTVKSLQQQQAAK |
| Ga0157373_104367211 | 3300013100 | Corn Rhizosphere | MKLTTGIVALAMMVGGAAVAQNPDAIDNARKTVKSLQQQQAAKPTPA |
| Ga0132256_1039059372 | 3300015372 | Arabidopsis Rhizosphere | MKLTLGILATAMMVSGAWAQSSDAIDNARSTAKSLQQK |
| Ga0182035_121490382 | 3300016341 | Soil | MKTAMKLTLGTLAIALMMSAAWGQNPDAIDNARSVA |
| Ga0182034_109836482 | 3300016371 | Soil | MKTAMKLTIGTLAIALMTSAAWGQNPDAIDNARSVAKSL |
| Ga0187782_106093871 | 3300017975 | Tropical Peatland | MKTAMKLTTGILAVAVMAGGVFSAKAAAQNPDAIDNARS |
| Ga0187823_102244952 | 3300017993 | Freshwater Sediment | MKLTTGILAMAMMVGGAWAQNPDAIDTARSTAKSLQQKQA |
| Ga0187880_14699932 | 3300018016 | Peatland | MKLTTGILAMAITMTAGAAFSARAVAQNPDAIDNARSIAKSLQQRQANDSSAALNP |
| Ga0187871_101099461 | 3300018042 | Peatland | MKLTKQVTTGILAVAITVTAGGLAAAKAAAQTPDAIDNARSTAKSL |
| Ga0187890_107516272 | 3300018044 | Peatland | MKTAMKLTTGIFAMAMMVGGSVAAQAQSTDAIDQARSIA |
| Ga0210400_110346771 | 3300021170 | Soil | MKLTTGILAMAIMVSGSAATKAAAQNPDAIDDARSTAKSLQQKQANDTNATP |
| Ga0222729_10021381 | 3300022507 | Soil | MKKLTIQFTFKLTTGLLATAMMVGGSWAAAAAQNPDAIDNARSTAKSLQQTQANQAPKA |
| Ga0222729_10689341 | 3300022507 | Soil | MKLTTGILAMAMVVCGSAATKAAAQNPDAIDTARSTVKSLQQNQDNP |
| Ga0242649_10571882 | 3300022509 | Soil | MKLTIKLTTGILATALVVGGSVAAHAQSPDAIDNARSTAKSLQQTQANPAPTKP |
| Ga0242662_102944642 | 3300022533 | Soil | MTATKLTTGILAMALMVGGFAATQAAAQNPDAIDNARSTAKSLQQKQDN |
| Ga0242654_103485651 | 3300022726 | Soil | MKLTTGILAMAMVVCGSAATKAAAQNPDAIDTARSTVKSLQQNQ |
| Ga0208714_10642461 | 3300025527 | Arctic Peat Soil | MKLTTGILAMALMTGGAAAQSPDAIDNARSTAKSLQQNSAPKAVAVTA |
| Ga0207693_103157791 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKAMKRTTGILAIALTMALGAAWTSKAAAQNPDAIDNARSVAKSLQQKQANDSDAA |
| Ga0207664_103163671 | 3300025929 | Agricultural Soil | MKLTTGIVAMAMMVGGAAVAQNPDAIDNARKTVKSL |
| Ga0209160_12278002 | 3300026532 | Soil | MAMKLTTGILVMAMMAGGAWAQNPDAIDNTRNVMKSLQAKQTAESNAALS |
| Ga0207762_10056764 | 3300027063 | Tropical Forest Soil | MKLTTGILAMAMMASGSAALAQSPDAIDNARSTAKSLQQQQ |
| Ga0209214_10178811 | 3300027071 | Forest Soil | MKTAMKLKTGTLAIALTMTMGAAFSTKAVAQNPDAIDNARSVAKSLQQK |
| Ga0209732_10190041 | 3300027117 | Forest Soil | MAMTVGGYAATNAVAQNPDAIDNARSIAKSLQQKQAN |
| Ga0209003_11121741 | 3300027576 | Forest Soil | MKLTTGILAIAMMAGGSWVAAGAQNADAIDNARSTAKSLQ |
| Ga0209422_10112381 | 3300027629 | Forest Soil | MAMKLTIGIVATAMMVSGAWAQNPDAIDNARSVAK |
| Ga0209420_11427151 | 3300027648 | Forest Soil | MKLTTSILAIAVMAGAAWAQNPDAIDNARSVAKSLQQKQANDT |
| Ga0209328_100781551 | 3300027727 | Forest Soil | MAMKLTIGIVATAMMVSGAWAQNPDAIDNARSTAKTLQQQ |
| Ga0209448_100767923 | 3300027783 | Bog Forest Soil | MKLTTGILATVMMAGGSWAAVAAQNPDAIDNARSIAKSLQQKQANDTNAALD |
| Ga0209139_101382522 | 3300027795 | Bog Forest Soil | MKTAMKLTTGILAITITMTAVGTLAAAQNTDAIDNARSIAKSLQQKQ |
| Ga0209166_105313632 | 3300027857 | Surface Soil | MKLTTGIVVMAIMAGVAFGQSPDAIDNARSTVKSLQQQQASGTTAVKPTP |
| Ga0209701_102366453 | 3300027862 | Vadose Zone Soil | MKLTTGILAVVMMTGAAWGQNPDAIDNARSVAKSLQQIKTNETNTAL |
| Ga0209167_107825432 | 3300027867 | Surface Soil | MKTAMKLTTGILTMAMMVGGPAAVMAAGQNPDAIDNARSVA |
| Ga0209380_102173471 | 3300027889 | Soil | MKLTTGILAMAMMVGGAWAQNPDAIDNARSTAKTLQQQQ |
| Ga0209624_104491422 | 3300027895 | Forest Soil | MAMKLTTSILAIAVMAGAAWAQNPDAIDNARSVAKSLQQKQANDTNAAL |
| Ga0209415_104026331 | 3300027905 | Peatlands Soil | MKTATKLTTGILAVVMVGAGWAPKAGAQNADAIDNARSTAKSLQQQQANPPNAAA |
| Ga0209526_106191711 | 3300028047 | Forest Soil | MKLTTGILAIAMMTGGSWAAAGAQNSDAIDNARSTAKSLQQKQA |
| Ga0311340_100291881 | 3300029943 | Palsa | MNKAMKLTTSILAVAVMTGGWGAATAAAQNPDAIDNAHSVAKSLQKKQA |
| Ga0302183_103614001 | 3300030509 | Palsa | MNKAMKLTTSILAVAVMTGGWGAATAAAQNPDAIDNAHSV |
| Ga0311372_114458251 | 3300030520 | Palsa | MKLTTGILAVAMTMTAGAAFGQNTDAIDNARSVAKSLQQIQTTKTN |
| Ga0311356_111278192 | 3300030617 | Palsa | MNKAMKLTTSILAVAVMTGGWGAATAAAQNPDAIDNAHSVAKSLQKKQ |
| Ga0302309_100878451 | 3300030687 | Palsa | MKLTTGILAVAMTMTAGAAFGQNPDAIDNARSVAKSLQQIQT |
| Ga0170824_1280177963 | 3300031231 | Forest Soil | MAMKLTIRLTTGILAMAMVVGGSAATTAVAQNADAIDNARSTAKSLQQKQD |
| Ga0265325_102601542 | 3300031241 | Rhizosphere | MKLTTGILAMVLMTGGAAAQSPDAIDNARSTAKSLQQTQANPAPKA |
| Ga0265339_100616621 | 3300031249 | Rhizosphere | MTAMKLTTGILALAMVVSGTAATKAVAQNPDAIDNARSIAKSLQQ |
| Ga0170819_115982871 | 3300031469 | Forest Soil | MKLTFKLTTKLTTGILAMALVVSGSVATKAVAQNADAIDNARSTAKSLQQ |
| Ga0310813_103778813 | 3300031716 | Soil | MKLTTVIVAMATMVGGAWGQNPDAIDNARSVAKTLQ |
| Ga0307475_106840292 | 3300031754 | Hardwood Forest Soil | MKLTTGILAVAMMAGGSAATKAVAQNPDAIDNARSIAKSLQQKQANDTNAAADA |
| Ga0307478_105264081 | 3300031823 | Hardwood Forest Soil | MKLTTGILALAMMTGGSWAAAAAQNPDAIDNARSTAKSLQQKQSNAP |
| Ga0307472_1003482763 | 3300032205 | Hardwood Forest Soil | MKTAMKLTTGTLAIALTMTMGAAFCAQAAAQNADAIDNARSVAKSLQ |
| Ga0335080_100319399 | 3300032828 | Soil | MKLTTSILAIAVMAGGAWAQNPDAIDNARSVAKSLQQKQAEGP |
| Ga0335084_111652041 | 3300033004 | Soil | MKLTTGILAIAISMTVGGSAAQRAWGQNPDAIDNARSVAKSLQQKQANDT |
| Ga0335073_119986982 | 3300033134 | Soil | MKLTTGIVAMAMMAGGLWAQNPDAIDTARSVAKSLQQQQATAATAPVAK |
| Ga0314863_086990_503_652 | 3300033804 | Peatland | MKLTTGILILAMMAGGSLAGKAAAQSPDAIDNARSAAKALQQKQANGTNP |
| ⦗Top⦘ |