| Basic Information | |
|---|---|
| Family ID | F094486 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MALGDEIDEIFRREVKSLPAYAKAQAAGGSGTAPPVDEMNQLLM |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.85 % |
| % of genes near scaffold ends (potentially truncated) | 96.23 % |
| % of genes from short scaffolds (< 2000 bps) | 95.28 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.396 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.075 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.547 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03006 | HlyIII | 13.21 |
| PF07883 | Cupin_2 | 5.66 |
| PF01386 | Ribosomal_L25p | 4.72 |
| PF00497 | SBP_bac_3 | 3.77 |
| PF14693 | Ribosomal_TL5_C | 1.89 |
| PF08448 | PAS_4 | 1.89 |
| PF03706 | LPG_synthase_TM | 0.94 |
| PF13473 | Cupredoxin_1 | 0.94 |
| PF00202 | Aminotran_3 | 0.94 |
| PF12697 | Abhydrolase_6 | 0.94 |
| PF07690 | MFS_1 | 0.94 |
| PF13188 | PAS_8 | 0.94 |
| PF14018 | DUF4234 | 0.94 |
| PF07366 | SnoaL | 0.94 |
| PF00085 | Thioredoxin | 0.94 |
| PF02653 | BPD_transp_2 | 0.94 |
| PF01039 | Carboxyl_trans | 0.94 |
| PF13456 | RVT_3 | 0.94 |
| PF00313 | CSD | 0.94 |
| PF01230 | HIT | 0.94 |
| PF00211 | Guanylate_cyc | 0.94 |
| PF01451 | LMWPc | 0.94 |
| PF01636 | APH | 0.94 |
| PF04542 | Sigma70_r2 | 0.94 |
| PF07228 | SpoIIE | 0.94 |
| PF13248 | zf-ribbon_3 | 0.94 |
| PF05235 | CHAD | 0.94 |
| PF01195 | Pept_tRNA_hydro | 0.94 |
| PF00188 | CAP | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 13.21 |
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 4.72 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.94 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.94 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.94 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.94 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.94 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.94 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.94 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.94 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.40 % |
| Unclassified | root | N/A | 6.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_12594531 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300000955|JGI1027J12803_103233788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300000956|JGI10216J12902_101384653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
| 3300000956|JGI10216J12902_103530783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300000956|JGI10216J12902_123918391 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300004479|Ga0062595_100192749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
| 3300005168|Ga0066809_10140974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300005171|Ga0066677_10587863 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005187|Ga0066675_11083868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300005330|Ga0070690_100990357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300005434|Ga0070709_10591341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300005436|Ga0070713_102045083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300005436|Ga0070713_102051955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300005437|Ga0070710_11338819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300005451|Ga0066681_10677422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300005467|Ga0070706_101726779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300005536|Ga0070697_100989008 | Not Available | 748 | Open in IMG/M |
| 3300005563|Ga0068855_100327488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
| 3300005566|Ga0066693_10284011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300005578|Ga0068854_100715480 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005598|Ga0066706_11076683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300005614|Ga0068856_100666631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
| 3300005614|Ga0068856_102074773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300005718|Ga0068866_11067289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
| 3300005719|Ga0068861_100317238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1356 | Open in IMG/M |
| 3300005843|Ga0068860_100998840 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300006046|Ga0066652_100209565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1682 | Open in IMG/M |
| 3300006046|Ga0066652_102100839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300006163|Ga0070715_10102056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300006572|Ga0074051_11770404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
| 3300006575|Ga0074053_11819740 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300006580|Ga0074049_13076131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300006794|Ga0066658_10547395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300006797|Ga0066659_10907298 | Not Available | 736 | Open in IMG/M |
| 3300006845|Ga0075421_102450033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300006854|Ga0075425_102800551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300006871|Ga0075434_101072973 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300006953|Ga0074063_14267909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
| 3300009094|Ga0111539_10694868 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300009100|Ga0075418_11107945 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300009137|Ga0066709_100726245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. PRF04-17 | 1431 | Open in IMG/M |
| 3300009176|Ga0105242_10470517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1189 | Open in IMG/M |
| 3300009176|Ga0105242_10885455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300010142|Ga0127483_1060365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300010320|Ga0134109_10176685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300010326|Ga0134065_10320757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300010329|Ga0134111_10426502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300010396|Ga0134126_11966199 | Not Available | 640 | Open in IMG/M |
| 3300010397|Ga0134124_11422837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300010401|Ga0134121_12814676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300012200|Ga0137382_10143864 | Not Available | 1611 | Open in IMG/M |
| 3300012201|Ga0137365_10751716 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012212|Ga0150985_117136602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300012350|Ga0137372_10540335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300012361|Ga0137360_10233482 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300012362|Ga0137361_11189961 | Not Available | 685 | Open in IMG/M |
| 3300012532|Ga0137373_10968446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300012893|Ga0157284_10192629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300012914|Ga0157297_10361869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300012988|Ga0164306_10838246 | Not Available | 744 | Open in IMG/M |
| 3300013096|Ga0157307_1058290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300013100|Ga0157373_10065203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2577 | Open in IMG/M |
| 3300014310|Ga0075331_1193862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300015356|Ga0134073_10308224 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300017657|Ga0134074_1216440 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018061|Ga0184619_10021475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2656 | Open in IMG/M |
| 3300018061|Ga0184619_10442731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_68_14 | 581 | Open in IMG/M |
| 3300018071|Ga0184618_10133927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300018073|Ga0184624_10311233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300018081|Ga0184625_10221447 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300018431|Ga0066655_11132752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300018465|Ga0190269_10146817 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300020059|Ga0193745_1068802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300024224|Ga0247673_1028570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300024284|Ga0247671_1009336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1526 | Open in IMG/M |
| 3300024287|Ga0247690_1023201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300025906|Ga0207699_11034615 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300025916|Ga0207663_10491309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
| 3300025919|Ga0207657_10912057 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300026118|Ga0207675_100388256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1374 | Open in IMG/M |
| 3300026306|Ga0209468_1158626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300026323|Ga0209472_1237424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300026330|Ga0209473_1031985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2376 | Open in IMG/M |
| 3300027725|Ga0209178_1381834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300027775|Ga0209177_10392972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300027821|Ga0209811_10259291 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300028587|Ga0247828_10535859 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300028714|Ga0307309_10052512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300028721|Ga0307315_10235633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300028755|Ga0307316_10093610 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300028768|Ga0307280_10185294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300028790|Ga0307283_10026485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
| 3300028807|Ga0307305_10108388 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300028819|Ga0307296_10237270 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300028828|Ga0307312_10037464 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
| 3300028828|Ga0307312_10057780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2332 | Open in IMG/M |
| 3300028872|Ga0307314_10210946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300028875|Ga0307289_10421240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300028881|Ga0307277_10160820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
| 3300028884|Ga0307308_10145267 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300028884|Ga0307308_10148211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1123 | Open in IMG/M |
| 3300028885|Ga0307304_10036361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1761 | Open in IMG/M |
| 3300030006|Ga0299907_10836767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300031740|Ga0307468_101558055 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032122|Ga0310895_10577436 | Not Available | 574 | Open in IMG/M |
| 3300032180|Ga0307471_100329003 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_125945314 | 3300000891 | Soil | MSLGDDVDEIFRREVKSLPAYAKAQSASGSGVAPPVDEMNQL |
| JGI1027J12803_1032337882 | 3300000955 | Soil | VALEDEIDEIFRREVKSLPAYAKAQAASGSGIAPPVNEMNELLM |
| JGI10216J12902_1013846531 | 3300000956 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPPVAEMNQLLMGLAVAAQRS |
| JGI10216J12902_1035307831 | 3300000956 | Soil | MALRDEIDGIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNQL |
| JGI10216J12902_1239183912 | 3300000956 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPPVDEMNQLLMGLAVAAQRS |
| Ga0062595_1001927491 | 3300004479 | Soil | MPVAIEEGDQVALEDEIDEIFRREVKSLPAYAKAQAASGSGIAPP |
| Ga0066809_101409742 | 3300005168 | Soil | MSLGDEIDNVFRREVKSLPAYEKAQAASGSGIAPPVDEMNHLLMGL |
| Ga0066677_105878631 | 3300005171 | Soil | MALGDEIDEIFRREVKSLPAYAKAQQAAGSGVAPPVDEMNQLLMG |
| Ga0066675_110838681 | 3300005187 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAATGSGLAPPVDEMNQLLMGLANA |
| Ga0070690_1009903571 | 3300005330 | Switchgrass Rhizosphere | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPVDEMNQLLMGLVVAAQR |
| Ga0070709_105913412 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDVALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPV |
| Ga0070713_1020450831 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDVALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMN |
| Ga0070713_1020519551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENEVALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMN |
| Ga0070710_113388191 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKENDVALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPP |
| Ga0066681_106774221 | 3300005451 | Soil | LPQIEQEMAMALGDEVDEILRREVKSLPAYAKAQAAGGSGVAPP |
| Ga0070706_1017267792 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MALGDEVDEIFRREVKSLPAYAKAQAASGSGTEPPVDEMNQLLMGLANAAQ |
| Ga0070697_1009890082 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MALGDEVDEIFRREVKSLPAYAKAQAASGSGIAPPVDEMNQLLMGLANAAQRS |
| Ga0068855_1003274883 | 3300005563 | Corn Rhizosphere | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLL |
| Ga0066693_102840112 | 3300005566 | Soil | MALGDEVDEILRREVKSLPAYAKAQAAGGSGVAPPVEEMNQLLMG |
| Ga0068854_1007154802 | 3300005578 | Corn Rhizosphere | MALGDEIDDIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLLMGLVVAVQR |
| Ga0066706_110766831 | 3300005598 | Soil | MALGDEVDEVFRREVKSLPAYAKAQAASGSGVAPPVDEMNHLLMGLANAAQ |
| Ga0068856_1006666311 | 3300005614 | Corn Rhizosphere | MALGDEIDEIFRREVKSLPAYLKAQAAAGSGVAPPVDEMNHLLMGLVVASQR |
| Ga0068856_1020747732 | 3300005614 | Corn Rhizosphere | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLLMGLVVAV |
| Ga0068866_110672891 | 3300005718 | Miscanthus Rhizosphere | MSLGDDVDDIFRREVKSLPAYAKAQSASGSGIAPPVDEMNQLLMGLANA |
| Ga0068861_1003172381 | 3300005719 | Switchgrass Rhizosphere | VALEDEIDEIFRREVKSLPAYAKAQAASGSGIAPPVNEMNELLMGLVV |
| Ga0068860_1009988401 | 3300005843 | Switchgrass Rhizosphere | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPV |
| Ga0066652_1002095651 | 3300006046 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAATGSGLAPPVDEMNQLLMGLA |
| Ga0066652_1021008392 | 3300006046 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAAGGSGVAPPVEEMN |
| Ga0070715_101020561 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VALKDEIDEIFRREVKSLPAYAKAQAAAGSGVAPPVDEMNELLMG |
| Ga0074051_117704045 | 3300006572 | Soil | MALTDEIDEIFRREVKTLPAYAKAQSASGSGIAPPVDE |
| Ga0074053_118197403 | 3300006575 | Soil | LWQTEQERAMSLGNEVDAVFRREVKSLPAYEKAQAARGSEIAPPVDEMN |
| Ga0074049_130761311 | 3300006580 | Soil | MALTDEIDEIFRREVKTLPAYAKAQSASGSGIAPP |
| Ga0066658_105473951 | 3300006794 | Soil | MALGDDVDQIFRREVKSLPAYAKAQAAGRSGLTPPVDEMNELLMGLVIATQRSF |
| Ga0066659_109072981 | 3300006797 | Soil | MALGDEIDEIFRREVKSLPVYAEAQQAAGSGVAPPVEQMNQ |
| Ga0075421_1024500332 | 3300006845 | Populus Rhizosphere | LALRDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNQL |
| Ga0075425_1028005511 | 3300006854 | Populus Rhizosphere | MALGDEIDDIFRREVKSLPAYAKAQQEAGSGVAVPVDEMNQLLM |
| Ga0075434_1010729731 | 3300006871 | Populus Rhizosphere | MALGDEIEEVFRREVKSLPAYAKAQAAGGSGVAPPV |
| Ga0074063_142679093 | 3300006953 | Soil | MSLGNEVDAVFRREVKSLPAYEKAQAASGSGVAPPV |
| Ga0111539_106948681 | 3300009094 | Populus Rhizosphere | MALGDEIEEVFRREVKSLPAYAKAQAAGGSGVAPSVEEMNQLL |
| Ga0075418_111079451 | 3300009100 | Populus Rhizosphere | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPSVEEMNQLLMG* |
| Ga0066709_1007262453 | 3300009137 | Grasslands Soil | LPQIEQETAMALGDEIDEIFRREVKSLPAYAKAQAAGGSGVAPPVEEMNHLLMGL |
| Ga0105242_104705174 | 3300009176 | Miscanthus Rhizosphere | MSLGNEIDAVFRREVKTLPAYEKAQAASGSGMAPPV |
| Ga0105242_108854551 | 3300009176 | Miscanthus Rhizosphere | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPP |
| Ga0127483_10603651 | 3300010142 | Grasslands Soil | MALGDEVDQIFRREVKSLPAYAKAQAASGSGVAPPVDEMNQLL |
| Ga0134109_101766851 | 3300010320 | Grasslands Soil | LPQIEQETAMALGDEIDEIFRREVKSLPAYAKAQDAGGSGVAPP |
| Ga0134065_103207571 | 3300010326 | Grasslands Soil | MALGDEIDEVFRREVKSLPAYAKAQQAAGSGIAPPVEEMNALLMGLTVA |
| Ga0134111_104265021 | 3300010329 | Grasslands Soil | MAMALGDEVDEIFRREVKSLPAYAKAQAATGSGLAPPVDEMNQLLMGLANAVQRSF |
| Ga0134126_119661992 | 3300010396 | Terrestrial Soil | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNQLLMGLV |
| Ga0134124_114228371 | 3300010397 | Terrestrial Soil | MALGDEVDEVFRREVKSLPAYAKAQAASGSGLAPPV |
| Ga0134121_128146762 | 3300010401 | Terrestrial Soil | MALGDEIDEVFRREVKSLPAYAKAQAAVGSGVAPPVDEMSQLL |
| Ga0137382_101438641 | 3300012200 | Vadose Zone Soil | MALGDEIDEIFRREVKSLPVYAEALQAAGSGVAPPVEQMNQLLMGLVVAAQR* |
| Ga0137365_107517161 | 3300012201 | Vadose Zone Soil | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPV |
| Ga0150985_1171366021 | 3300012212 | Avena Fatua Rhizosphere | MALGDEIDEIFRREVKSLPAYSKAQAAAGSGVAPPVDEMNHLLMGLVIASQRS |
| Ga0137372_105403351 | 3300012350 | Vadose Zone Soil | MAMALGDEVDQIFRREVKSLPAYAKAQAATGSGLAPPVDEMNQLLM |
| Ga0137360_102334823 | 3300012361 | Vadose Zone Soil | MALGDEIDEIFRREVKSLPVYAEALQAAGSGVAPPVEQMNQLLMS |
| Ga0137361_111899611 | 3300012362 | Vadose Zone Soil | MSLGDEIDEVFRREVKSLPVYAEAQQAAGSGVAPPVEEMNQLLMGLVVAAQRS |
| Ga0137373_109684463 | 3300012532 | Vadose Zone Soil | VLPQPKKEMAMALGDEVDEIFRREVKSLPAYAKAQAATGSGLAPPVDEMNQLLMGLA |
| Ga0157284_101926292 | 3300012893 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAAAGSGIAPPVDEMNQLLMGLAN |
| Ga0157297_103618692 | 3300012914 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAAAGSGIAPPVDEMNQLLMGLA |
| Ga0164306_108382462 | 3300012988 | Soil | MALGDEIDEVFRREVKSLPVYAEAQQAAGSGVAPPVD |
| Ga0157307_10582901 | 3300013096 | Soil | MPVAIEEGDQVALEDEIDEIFRREVKSLPAYAKAQAASGSGIAPPVNEMNELLM |
| Ga0157373_100652031 | 3300013100 | Corn Rhizosphere | MKENEVALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEE |
| Ga0075331_11938621 | 3300014310 | Natural And Restored Wetlands | MTALGDEIDRIFRREVKSLPAFEKAQAASGSGIAPPVHEMNQMLM |
| Ga0134073_103082241 | 3300015356 | Grasslands Soil | MALGDEIDEIFRREVKSLPAYAKAQQAAGSGVAPPVDEMNQLLMGLAIAAQR |
| Ga0134074_12164401 | 3300017657 | Grasslands Soil | MALGGEVDEIFRREVKSLPAYAKAQAATGSGLAPP |
| Ga0184619_100214751 | 3300018061 | Groundwater Sediment | MSLGDEIDKVFRREVKSLPAYEKAQAASGSGVAPPVDEMNQLLMGLV |
| Ga0184619_104427311 | 3300018061 | Groundwater Sediment | MALGDEIDEIFRREVKSLPAYAKAQAAGGSGVAPPVEEMNRL |
| Ga0184618_101339273 | 3300018071 | Groundwater Sediment | MALGDEVDQIFRREVKSLPAYAKAEAASGSGVAPPVDEMN |
| Ga0184624_103112331 | 3300018073 | Groundwater Sediment | MSLGNEVDAVFRREVKSLPAYEKAQAASGSGIAPPVDEMNQLL |
| Ga0184625_102214471 | 3300018081 | Groundwater Sediment | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLLMGL |
| Ga0066655_111327522 | 3300018431 | Grasslands Soil | MALGDEVDQIFRREVKSLPAYAKPQAGSGSALSPPGDEMNQLPMALATAGQPSF |
| Ga0190269_101468171 | 3300018465 | Soil | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPVD |
| Ga0193745_10688021 | 3300020059 | Soil | MALGDEIDEIFRREVKSLPAYAKAQAAGGSGTAPPVDEMNQLLMGL |
| Ga0247673_10285701 | 3300024224 | Soil | VALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMNEL |
| Ga0247671_10093364 | 3300024284 | Soil | VALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMNELLMGLVVASQRS |
| Ga0247690_10232011 | 3300024287 | Soil | VALKDDIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMNELLMG |
| Ga0207699_110346151 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPP |
| Ga0207663_104913092 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VALKDEIDEIFRREVKSLPAYAKAQAAAGSGVAPPVDEMNELLMGLVVAS |
| Ga0207657_109120571 | 3300025919 | Corn Rhizosphere | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPVDEMNQLLMGL |
| Ga0207675_1003882564 | 3300026118 | Switchgrass Rhizosphere | VALEDEIDEIFRREVKSLPAYAKAQAASGSGIAPPVNEMNELLMGLVVASQRS |
| Ga0209468_11586262 | 3300026306 | Soil | MALGDEIDEIFRREVKSLPAYAKAQQASGSGVTPPVDEMNQLLMGL |
| Ga0209472_12374241 | 3300026323 | Soil | MALGDEVDEILRREVKSLPAYAKAQAAGGSGVAPPVEEMNQLLM |
| Ga0209473_10319855 | 3300026330 | Soil | MALGDEVDEILRREVKSLPAYAKAQAAGGSGVAPPVEEMNQLLMGLVV |
| Ga0209178_13818341 | 3300027725 | Agricultural Soil | MKENEVALKDDIDEIFRREVKSLPAYARAQAASGSGVAPPVEEMNELLMGLVVASQRS |
| Ga0209177_103929722 | 3300027775 | Agricultural Soil | MALGDEIDEIFRREVKSLPAYAKAQAASGSGVAPPVEEMNQ |
| Ga0209811_102592912 | 3300027821 | Surface Soil | MALGDEIDEVFRREVKSLPAYAKAQAAVGSGVAPPVDEMNQLLM |
| Ga0247828_105358591 | 3300028587 | Soil | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPVDEMNQLL |
| Ga0307309_100525121 | 3300028714 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPPVEEMNHLL |
| Ga0307315_102356331 | 3300028721 | Soil | MALGDEVDEIFRHEVKSLPAYAKAQAASGSGLAPPVDEMNQLLMGLANA |
| Ga0307316_100936103 | 3300028755 | Soil | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLLMG |
| Ga0307280_101852941 | 3300028768 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPP |
| Ga0307283_100264854 | 3300028790 | Soil | MSLGDEVDEIFRREVKSLPAYAKAQSASGSGVAPP |
| Ga0307305_101083883 | 3300028807 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPPVEEMNHLLMGLVVAVQR |
| Ga0307296_102372702 | 3300028819 | Soil | MALGDEVDEIFRHEVKSLPAYAKAQAASGSGLAPPVDEMNQLLMGLANAAQRSL |
| Ga0307312_100374646 | 3300028828 | Soil | MALGDEIDEIFRHEVKSLPAYAKAQAASGSGVAPPVDEMNHLLM |
| Ga0307312_100577803 | 3300028828 | Soil | MALGDEIDEIFRREVKSLPAYAKAQAAGGSGTAPPVDEMNQLLM |
| Ga0307314_102109461 | 3300028872 | Soil | MSLGDEIDKVFRREVKSVPAYEKAQAASGSGVAPPVDEMNQLLMGLVIA |
| Ga0307289_104212401 | 3300028875 | Soil | MALGDEIDEIFRREVKSLPAYEKAQAAGGSGVAPPVEEMNHLLMGLVIAVQRSFH |
| Ga0307277_101608201 | 3300028881 | Soil | MALGDEIDEVFRREVKSLPAYAKAQAAGGSGVAPPVEEMNQLLMGLVVGVQRSL |
| Ga0307308_101452673 | 3300028884 | Soil | MSLGDEIDKVFRREVKSLPAYEKAQAASGSGVAPPVDEMNQLLMGLVIAAQRSC |
| Ga0307308_101482114 | 3300028884 | Soil | MSLGDEVDEIFRREVKSLPAYAKAQSASGSGVAPPVDE |
| Ga0307304_100363611 | 3300028885 | Soil | MALGDEVDEIFRREVKSLPAYAKAQAASGSGLAPPVDEMNQ |
| Ga0299907_108367671 | 3300030006 | Soil | MTALGEEIDQIFRREVKSLPAFAKAQAASGSGIAPPVDEMNQMLM |
| Ga0307468_1015580552 | 3300031740 | Hardwood Forest Soil | MALGDEIDEIFRREVKSLPAYAKAQGAAGSGVAPPVDEMNQLLMSLVVAAQRSF |
| Ga0310895_105774362 | 3300032122 | Soil | MKETEVALKDEIDEIFRREVKSLPAYAKAQAAAGSGVAPPVDEMN |
| Ga0307471_1003290031 | 3300032180 | Hardwood Forest Soil | MTLGDEIDEVFRREVKSLPVYAEAQQAAGSGVAPPVDQMNQLL |
| ⦗Top⦘ |