| Basic Information | |
|---|---|
| Family ID | F094463 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRTKTNCKAGKLSANHNETLVRDNGKNLKVKTALRAGKKAAS |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 74 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.21 % |
| % of genes near scaffold ends (potentially truncated) | 35.85 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 50 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.774 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.245 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.925 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 74 Family Scaffolds |
|---|---|---|
| PF13424 | TPR_12 | 32.43 |
| PF00005 | ABC_tran | 6.76 |
| PF03412 | Peptidase_C39 | 2.70 |
| PF13432 | TPR_16 | 2.70 |
| PF00072 | Response_reg | 1.35 |
| PF01011 | PQQ | 1.35 |
| PF13570 | PQQ_3 | 1.35 |
| PF13437 | HlyD_3 | 1.35 |
| PF00763 | THF_DHG_CYH | 1.35 |
| PF05345 | He_PIG | 1.35 |
| COG ID | Name | Functional Category | % Frequency in 74 Family Scaffolds |
|---|---|---|---|
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 1.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.77 % |
| All Organisms | root | All Organisms | 46.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004120|Ga0058901_1082912 | Not Available | 652 | Open in IMG/M |
| 3300004134|Ga0058906_1321766 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004139|Ga0058897_11145658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300004157|Ga0062590_102734332 | Not Available | 526 | Open in IMG/M |
| 3300005174|Ga0066680_10829783 | Not Available | 554 | Open in IMG/M |
| 3300005336|Ga0070680_100430337 | Not Available | 1126 | Open in IMG/M |
| 3300005439|Ga0070711_100086921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2243 | Open in IMG/M |
| 3300005445|Ga0070708_102263355 | Not Available | 501 | Open in IMG/M |
| 3300005458|Ga0070681_10073795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3374 | Open in IMG/M |
| 3300005458|Ga0070681_10073795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3374 | Open in IMG/M |
| 3300005536|Ga0070697_100250034 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300005536|Ga0070697_100672285 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005536|Ga0070697_100672285 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005536|Ga0070697_100672285 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005537|Ga0070730_10027965 | All Organisms → cellular organisms → Bacteria | 4287 | Open in IMG/M |
| 3300005537|Ga0070730_10027965 | All Organisms → cellular organisms → Bacteria | 4287 | Open in IMG/M |
| 3300005538|Ga0070731_10004755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11494 | Open in IMG/M |
| 3300005538|Ga0070731_10004755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11494 | Open in IMG/M |
| 3300005538|Ga0070731_10244362 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005538|Ga0070731_10244362 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005538|Ga0070731_10244362 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005586|Ga0066691_10326443 | Not Available | 907 | Open in IMG/M |
| 3300005598|Ga0066706_10166718 | Not Available | 1670 | Open in IMG/M |
| 3300006163|Ga0070715_10352751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300006237|Ga0097621_101338912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300006358|Ga0068871_100764555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300006358|Ga0068871_100764555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300006903|Ga0075426_11205450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300009012|Ga0066710_100180383 | Not Available | 2982 | Open in IMG/M |
| 3300009012|Ga0066710_100180383 | Not Available | 2982 | Open in IMG/M |
| 3300009012|Ga0066710_100180383 | Not Available | 2982 | Open in IMG/M |
| 3300009038|Ga0099829_11068624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300009038|Ga0099829_11068624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300009089|Ga0099828_10594350 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300009143|Ga0099792_10956384 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009176|Ga0105242_12928160 | Not Available | 528 | Open in IMG/M |
| 3300009545|Ga0105237_11435222 | Not Available | 697 | Open in IMG/M |
| 3300010401|Ga0134121_11215030 | Not Available | 754 | Open in IMG/M |
| 3300011120|Ga0150983_13161809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300011120|Ga0150983_14052910 | Not Available | 541 | Open in IMG/M |
| 3300011120|Ga0150983_15362337 | Not Available | 581 | Open in IMG/M |
| 3300011120|Ga0150983_15362337 | Not Available | 581 | Open in IMG/M |
| 3300011120|Ga0150983_15388249 | Not Available | 899 | Open in IMG/M |
| 3300011120|Ga0150983_15388249 | Not Available | 899 | Open in IMG/M |
| 3300011120|Ga0150983_16567274 | Not Available | 525 | Open in IMG/M |
| 3300011120|Ga0150983_16567274 | Not Available | 525 | Open in IMG/M |
| 3300011271|Ga0137393_11030502 | Not Available | 700 | Open in IMG/M |
| 3300012363|Ga0137390_11322118 | Not Available | 666 | Open in IMG/M |
| 3300012469|Ga0150984_115275214 | Not Available | 582 | Open in IMG/M |
| 3300012929|Ga0137404_10661707 | Not Available | 942 | Open in IMG/M |
| 3300012984|Ga0164309_10726855 | Not Available | 791 | Open in IMG/M |
| 3300013297|Ga0157378_10985062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
| 3300015245|Ga0137409_11504035 | Not Available | 522 | Open in IMG/M |
| 3300015371|Ga0132258_12739315 | Not Available | 1229 | Open in IMG/M |
| 3300015371|Ga0132258_12739315 | Not Available | 1229 | Open in IMG/M |
| 3300015371|Ga0132258_12739315 | Not Available | 1229 | Open in IMG/M |
| 3300022504|Ga0242642_1037562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300022506|Ga0242648_1060448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300022507|Ga0222729_1073883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300022508|Ga0222728_1079441 | Not Available | 594 | Open in IMG/M |
| 3300022510|Ga0242652_1054150 | Not Available | 513 | Open in IMG/M |
| 3300022531|Ga0242660_1067492 | Not Available | 817 | Open in IMG/M |
| 3300022531|Ga0242660_1067492 | Not Available | 817 | Open in IMG/M |
| 3300022531|Ga0242660_1075050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300022531|Ga0242660_1075050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300022531|Ga0242660_1220951 | Not Available | 529 | Open in IMG/M |
| 3300022531|Ga0242660_1229528 | Not Available | 521 | Open in IMG/M |
| 3300022531|Ga0242660_1229528 | Not Available | 521 | Open in IMG/M |
| 3300022531|Ga0242660_1229528 | Not Available | 521 | Open in IMG/M |
| 3300022532|Ga0242655_10191157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300022533|Ga0242662_10071701 | Not Available | 938 | Open in IMG/M |
| 3300022533|Ga0242662_10071701 | Not Available | 938 | Open in IMG/M |
| 3300022533|Ga0242662_10155950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300022533|Ga0242662_10211700 | Not Available | 614 | Open in IMG/M |
| 3300022533|Ga0242662_10277802 | Not Available | 552 | Open in IMG/M |
| 3300022533|Ga0242662_10277802 | Not Available | 552 | Open in IMG/M |
| 3300022533|Ga0242662_10277802 | Not Available | 552 | Open in IMG/M |
| 3300022717|Ga0242661_1034282 | Not Available | 890 | Open in IMG/M |
| 3300022717|Ga0242661_1069587 | Not Available | 691 | Open in IMG/M |
| 3300022717|Ga0242661_1069587 | Not Available | 691 | Open in IMG/M |
| 3300022717|Ga0242661_1069587 | Not Available | 691 | Open in IMG/M |
| 3300022717|Ga0242661_1152259 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300022722|Ga0242657_1109478 | Not Available | 690 | Open in IMG/M |
| 3300022724|Ga0242665_10194769 | Not Available | 665 | Open in IMG/M |
| 3300022724|Ga0242665_10209755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300022724|Ga0242665_10291669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300022724|Ga0242665_10291669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300025906|Ga0207699_10510310 | Not Available | 869 | Open in IMG/M |
| 3300025912|Ga0207707_10200314 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300025912|Ga0207707_10200314 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300025934|Ga0207686_11799948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300027857|Ga0209166_10040254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium violaceum → Archangium violaceum Cb vi76 | 2785 | Open in IMG/M |
| 3300027857|Ga0209166_10040254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium violaceum → Archangium violaceum Cb vi76 | 2785 | Open in IMG/M |
| 3300027869|Ga0209579_10005124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 8977 | Open in IMG/M |
| 3300027869|Ga0209579_10300547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium | 865 | Open in IMG/M |
| 3300027869|Ga0209579_10300547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium | 865 | Open in IMG/M |
| 3300027869|Ga0209579_10300547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium | 865 | Open in IMG/M |
| 3300027869|Ga0209579_10640470 | Not Available | 576 | Open in IMG/M |
| 3300028381|Ga0268264_11343232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300031231|Ga0170824_124082358 | Not Available | 525 | Open in IMG/M |
| 3300031231|Ga0170824_124082358 | Not Available | 525 | Open in IMG/M |
| 3300031469|Ga0170819_10647998 | Not Available | 525 | Open in IMG/M |
| 3300032180|Ga0307471_102068662 | Not Available | 715 | Open in IMG/M |
| 3300032180|Ga0307471_102068662 | Not Available | 715 | Open in IMG/M |
| 3300032180|Ga0307471_102323849 | Not Available | 677 | Open in IMG/M |
| 3300032205|Ga0307472_101615496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 13.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004134 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058901_10829122 | 3300004120 | Forest Soil | KMRTKTNCKAGSWGKNHSETMLRDARKSLKVRTAVRAGAIKR* |
| Ga0058906_13217661 | 3300004134 | Forest Soil | KMRTKSNVKAGGRSINHNETMVRDNARSLKVRTNVRAGKRIA* |
| Ga0058897_111456582 | 3300004139 | Forest Soil | MNTKTHCKAGKLTCNHSETLVRDNGKSLKVKTALRAGKKAA* |
| Ga0062590_1027343321 | 3300004157 | Soil | MRTKTSCKAGKSAWNNHNETLVRATRKNLKVRTAVRAGAVKR* |
| Ga0066680_108297831 | 3300005174 | Soil | MKTKTNCKAGKLSANHSETLVRDNGKSLKVKTAPWAGADTRIS* |
| Ga0070680_1004303371 | 3300005336 | Corn Rhizosphere | ERRPIKMRTKTNCKAGGTSLNHNETLVRDNGKNLKVKTALRAGKKAY* |
| Ga0070711_1000869212 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKTNCKAGRMAANHSETLVRDARKNLKVRTAVRAGAIKR* |
| Ga0070708_1022633552 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKTNCKAGNLAANHSETLVRATRKNLKVRTAVRAGAIKR* |
| Ga0070681_100737952 | 3300005458 | Corn Rhizosphere | MRTKTNCKAGGTSLNHNETLVRDNGKNLKVKTALRAGKKAY* |
| Ga0070681_100737954 | 3300005458 | Corn Rhizosphere | MRTKTNCKAGKLSANHNETLVRDNGKNLKVKTALRAGKKAAS* |
| Ga0070697_1002500342 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKSNVKAGGRSVNHNETLVRDNGKNLKVRTNVRAGKKAQ* |
| Ga0070697_1006722852 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKTNCKAGYNDTDTKLATNHSETLVRDNGKRLKVKTALRAGNKSV* |
| Ga0070697_1006722853 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKTNCKAGYNDSNTKLAANHNETLVRDNGKRLKVKTALRAGNKSV* |
| Ga0070697_1006722854 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKTNCKAGHNDGNDKLSANHNETLVRDNGKRLKVKTALRAGAAKRNS* |
| Ga0070730_100279652 | 3300005537 | Surface Soil | MRTKTNFKAGKLAANHSETMVRDTRKNLKVRTAVRAGAVKR* |
| Ga0070730_100279653 | 3300005537 | Surface Soil | MRTKTNCKAGRLAANHSETMVRDTRKNLKVRTAVRAGAVKR* |
| Ga0070731_1000475510 | 3300005538 | Surface Soil | MRTKTNCKAGKISSNHSETLVRDNGKNLKVKTALRAGKRAT* |
| Ga0070731_100047559 | 3300005538 | Surface Soil | MKTQTTIKAGLKGTTFQHNETLVRDNGKNLKVKTAVRAGKKGR* |
| Ga0070731_102443622 | 3300005538 | Surface Soil | MKTKTNCKAGAYDVRLSANHSETLVRDNGKNLKIKTALRAGKKAK* |
| Ga0070731_102443623 | 3300005538 | Surface Soil | VWIEMKTKTNCKAGKVVVNHSETILRDNGTSLKIKTALRAGKKAQ* |
| Ga0070731_102443624 | 3300005538 | Surface Soil | MKTKTNFKAGRVAYNHSETLVRDNDKNLKIKTALRAGKKSA* |
| Ga0066691_103264433 | 3300005586 | Soil | MRTKSNVKAGGTSLNHNETLVRDNGKNLKVRTNVRAGKKAQ* |
| Ga0066706_101667181 | 3300005598 | Soil | MRTKTNCKAGGESLNHSETLVRDNGKSLKVKTALWAGAPTRIS* |
| Ga0070715_103527511 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | CYYAGQEDTQMRTKTTCKAGKSAWNNHSETLVRETRKNLKVRTAVRAGALKR* |
| Ga0097621_1013389122 | 3300006237 | Miscanthus Rhizosphere | MKTKTNCKAGGPYANHNETLVRDNGKNLKVKTALRAGKKAESR* |
| Ga0068871_1007645552 | 3300006358 | Miscanthus Rhizosphere | MSTKTNCKAGGDKISANHNETLVRDNGKNLKVKTALRAGKKAAS* |
| Ga0068871_1007645553 | 3300006358 | Miscanthus Rhizosphere | MKTKTNCKAGGPYANHNETLVRDNGKNLKVKTALRAGKKIN* |
| Ga0075426_112054502 | 3300006903 | Populus Rhizosphere | LTKTNCKAGRLAANHSETMLRGTRKNLKVRTAVRAGAVKR* |
| Ga0066710_1001803832 | 3300009012 | Grasslands Soil | MRTKTNCKAGKVIANHSETLVRDNGKSLKVKTALWAGAPTRIS |
| Ga0066710_1001803833 | 3300009012 | Grasslands Soil | MRTKTNCKAGSMTYNHSETLVRDNGKSLKVKTALRAGYKKVN |
| Ga0066710_1001803834 | 3300009012 | Grasslands Soil | MKTKTNFKAGGTSLNHSETLVRDNGKRLKVKTALRAGYKSV |
| Ga0099829_110686241 | 3300009038 | Vadose Zone Soil | KAGGKDLNHSETLVRDNGKSLKVKTALRAGKKATS* |
| Ga0099829_110686242 | 3300009038 | Vadose Zone Soil | MKTKTNCKAGGIRLTNHSETLVRDNGKSLKVKTALWAGAAKRIS* |
| Ga0099828_105943502 | 3300009089 | Vadose Zone Soil | MRTKSNVKAGGTSLNHNETLVRDNGKNLKVRTNVRGGKKAQ* |
| Ga0099792_109563842 | 3300009143 | Vadose Zone Soil | MKTRTNCKAGASYDVRLAANHCETLLRDSSKSLKIKTA |
| Ga0105242_129281601 | 3300009176 | Miscanthus Rhizosphere | IKMRTKTNCKAGGKSLNHNETLVRDNGKNLKVKTALRAGKKAESR* |
| Ga0105237_114352222 | 3300009545 | Corn Rhizosphere | MRTKTNCKAGGVSLNHNETLVRDNGKSLKVKTALRAGKKAAS* |
| Ga0134121_112150302 | 3300010401 | Terrestrial Soil | MRTKTNCKAGLVDKLATNHNETLVRDNGKKLKVKTALRAGKKAAS* |
| Ga0150983_131618091 | 3300011120 | Forest Soil | KTKTNCKAGGMPDNHNETLVRDNGKRLTVKTALRAGKKAVS* |
| Ga0150983_140529101 | 3300011120 | Forest Soil | MRTKTNCKAGRMSANHSETMVRDTRKNLRVRTAVRAGAIKR* |
| Ga0150983_153623371 | 3300011120 | Forest Soil | KTMKTRTNCKAGIRLSGNHNETLVRDSSKNLKIKTALRAGKKAER* |
| Ga0150983_153623373 | 3300011120 | Forest Soil | MRTKTSCKSGKVTANHNEKLVRDCGKSLKVQTALRAGKKAA* |
| Ga0150983_153882491 | 3300011120 | Forest Soil | KMRTKTNCKAGKMAGNHSETMVRDTRKNLKVRTAVRAGAIKR* |
| Ga0150983_153882492 | 3300011120 | Forest Soil | MRTKTNCKAGSWGKNHSETMLRDARKSLKVRTAVRAGAIKR* |
| Ga0150983_165672741 | 3300011120 | Forest Soil | MRTKSNVKAGGAWQNHNETLVRDIAKNLKVRTNVRAGKKAQ* |
| Ga0150983_165672742 | 3300011120 | Forest Soil | KMRTKSNVKAGGINLGNHNETLVRDNAKNLKVRTNVRAGNKRAAQ* |
| Ga0137393_110305022 | 3300011271 | Vadose Zone Soil | QMRTKTNCKAGRLAANHSETLVRATRKNLKVRTAVRAGAIKR* |
| Ga0137390_113221181 | 3300012363 | Vadose Zone Soil | MRTKTNCKAGKLAANHSETLMRDTRKNLKVRTAVRAGAIKR* |
| Ga0150984_1152752141 | 3300012469 | Avena Fatua Rhizosphere | TMRTKTNCKAGQDKIATNHNETLVRDNGKNLKVKTALRAGKKAAS* |
| Ga0137404_106617072 | 3300012929 | Vadose Zone Soil | MKTKTNCKAGLITGSGPTGGKLIANHCETVLRDSGKSLKVKTALRAGKKAA* |
| Ga0164309_107268552 | 3300012984 | Soil | TCKAGKSAWNNHSETLVRETRKNLKVRTAVRAGALKR* |
| Ga0157378_109850622 | 3300013297 | Miscanthus Rhizosphere | MRTKTNCKAGGTSLNHNETLARDNGKNLKVKTALRAGKKAAS* |
| Ga0137409_115040352 | 3300015245 | Vadose Zone Soil | MRTKSNLKAGKCVANHNETLVRDNGKNLKVRTNVRAGYKRA* |
| Ga0132258_127393152 | 3300015371 | Arabidopsis Rhizosphere | MCGRRNREMRTKTNCKAGGKDLNHSETLVRDNGKRLKVKTALRAGKKAVA* |
| Ga0132258_127393153 | 3300015371 | Arabidopsis Rhizosphere | MKTKTNCKAGGHNLNHSETLIRDNCKRLKVKTALRAGKKAVA* |
| Ga0132258_127393154 | 3300015371 | Arabidopsis Rhizosphere | MKTKTNCKAGRLSANHNETLVRDNGKSLKVKTALWAANKAVD* |
| Ga0242642_10375622 | 3300022504 | Soil | MRTKTNCKAGKLTANHSETMLRGTRKNLKVRTAVRAGAVKR |
| Ga0242648_10604481 | 3300022506 | Soil | KMRTKTNCKAGKLTANHSETMLRGTRKNLKVRTAVRAGAVKR |
| Ga0222729_10738831 | 3300022507 | Soil | EMKTKTNCKAGKLACNHSETLVRDNGKSLKVKTALRAGKKAA |
| Ga0222728_10794412 | 3300022508 | Soil | MKMRTKTNCKAGRMSANHSETMVRDTRKNLRVRTAVRAGAIKR |
| Ga0242652_10541501 | 3300022510 | Soil | KMRTKTNCKAGSWGKNHSETMLRDARKSLKVRTAVRAGAIKR |
| Ga0242660_10674922 | 3300022531 | Soil | MRTKTNCKAGKLSANHSETMVRDTRKNLKVRTTVRAGAIKR |
| Ga0242660_10674923 | 3300022531 | Soil | GGTKMRTKTNCKAGRLAANHSETMLRCTRKNLKVRTAVRAGAVKR |
| Ga0242660_10750501 | 3300022531 | Soil | KTKTNCKAGGIPDNHNETLVRDNGKRLTVKTALRAGKKAVS |
| Ga0242660_10750502 | 3300022531 | Soil | MNTKTHCKAGKLACNHSETLVRDNGKSLKVKTALRAGKKAA |
| Ga0242660_12209511 | 3300022531 | Soil | KMTTKTNLKAGGASFNHNETLVRDNGKNLKVKSQVRAGWLKKVY |
| Ga0242660_12295281 | 3300022531 | Soil | MKTKTNCKAGGQNLNHSETLVRDNGKNLKVKTALRAGKKAA |
| Ga0242660_12295282 | 3300022531 | Soil | MKTKTNCKAGGKDLNHSETLVRDNGRNLKVKTALRAGKKAA |
| Ga0242660_12295283 | 3300022531 | Soil | KTKTNCKAGAAAMNHSETLVRDNGKNLKVKTALRAGKKAA |
| Ga0242655_101911571 | 3300022532 | Soil | KMRTKTNCKAGRRSANHSETMVRDTRKNLKVRTAVRAGAIKR |
| Ga0242662_100717012 | 3300022533 | Soil | VKTKTNCQAGRLAGNHSETLVRDSGKNLKVKTALRAGKKAK |
| Ga0242662_100717013 | 3300022533 | Soil | MKTKTNCKAGKLAVNHSETLVRDSGKNLKFKTALRAGKKAKNQNEL |
| Ga0242662_101559503 | 3300022533 | Soil | TNCKAGRMAANHSETLVRDARKNLKVRTAVRAGAIKR |
| Ga0242662_102117001 | 3300022533 | Soil | KTQTTIKAGLKGTTFQHNETLVRDNGKNLKVKTAVRAGKKGR |
| Ga0242662_102778021 | 3300022533 | Soil | KTKTNCNAGRMGTSVQHNETLVRDSSKSLKVKTALRAGKKAKS |
| Ga0242662_102778022 | 3300022533 | Soil | MRTKTNCKSGKITANHSETLLRDMHKSLKVKTALRAGYKRA |
| Ga0242662_102778023 | 3300022533 | Soil | MRTKTNCKSGKISANHSETLLRDVRKSLTVKTALRAGKRAA |
| Ga0242661_10342823 | 3300022717 | Soil | KTKTNCKVGKLAANHNETLVRDNGKSLRVKTALRAGKKAR |
| Ga0242661_10695871 | 3300022717 | Soil | TTIKAALKGTTFQHNETLVRDNGKNLKVKTAVRAGKKADR |
| Ga0242661_10695872 | 3300022717 | Soil | MKTKTNSKAGSRATGLQHNETLIRDCGRNLKVKTALRAGKKSR |
| Ga0242661_10695874 | 3300022717 | Soil | MRTKTNCKAGKISSNHSETLVRDNGKNLKVKTALRAGKRAT |
| Ga0242661_11522592 | 3300022717 | Soil | KMKTKSNVRAGGTSLNHSETLVRDNGKNLKVRTSVRAGKRSA |
| Ga0242657_11094782 | 3300022722 | Soil | RTKTNCKAGSWGKNHSETMLRDARKSLKVRTAVRAGAIKR |
| Ga0242665_101947692 | 3300022724 | Soil | MTTKTNLKAGGASFNHNETLVRDNGKNLKVKSQVRAGWLKKVY |
| Ga0242665_102097553 | 3300022724 | Soil | KTKTNCKAGGMPDNHNETLVRDNGKRLTVKTALRAGKKAVS |
| Ga0242665_102916692 | 3300022724 | Soil | MRTKTNCKAGKLASNHSETMVRDARKNLKVRTAVRAGAIKR |
| Ga0242665_102916693 | 3300022724 | Soil | RTKTNCKAGKMAGNHSETMVRDTRKNLKVRTAVRAGAIKR |
| Ga0207699_105103101 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NCKAGRMSANHSETMVRDTRKNLKVRTTVRAGAIKR |
| Ga0207707_102003143 | 3300025912 | Corn Rhizosphere | MRTKTNCKAGGTSLNHNETLVRDNGKNLKVKTALRAGKKAY |
| Ga0207707_102003144 | 3300025912 | Corn Rhizosphere | MRTKTNCKAGKLSANHNETLVRDNGKNLKVKTALRAGKKAAS |
| Ga0207686_117999482 | 3300025934 | Miscanthus Rhizosphere | IKMRTKTNCKAGGKSLNHNETLVRDNGKNLKVKTALRAGKKAESR |
| Ga0209166_100402542 | 3300027857 | Surface Soil | MRTKTNCKAGRLAANHSETMVRDTRKNLKVRTAVRAGAVKR |
| Ga0209166_100402543 | 3300027857 | Surface Soil | MRTKTNFKAGKLAANHSETMVRDTRKNLKVRTAVRAGAVKR |
| Ga0209579_100051247 | 3300027869 | Surface Soil | MKTQTTIKAGLKGTTFQHNETLVRDNGKNLKVKTAVRAGKKGR |
| Ga0209579_103005472 | 3300027869 | Surface Soil | MKTKTNCKAGAYDVRLSANHSETLVRDNGKNLKIKTALRAGKKAK |
| Ga0209579_103005473 | 3300027869 | Surface Soil | MKTKTNCKAGKVVVNHSETILRDNGTSLKIKTALRAGKKAQ |
| Ga0209579_103005474 | 3300027869 | Surface Soil | MKTKTNFKAGRVAYNHSETLVRDNDKNLKIKTALRAGKKSA |
| Ga0209579_106404701 | 3300027869 | Surface Soil | MKTKTNCKAGDGFRIAANHSETLLRDSGKNLKVKTALRAGKKAK |
| Ga0268264_113432321 | 3300028381 | Switchgrass Rhizosphere | CGPERSPPKMRTKTNCKAGGNNLNHGETLVRDNSKSLKVKTALRAGKKSA |
| Ga0170824_1240823581 | 3300031231 | Forest Soil | MRTTTNCKAGKGGGGVYNHNETLVRAARKNLKIRTAVRAGAIKR |
| Ga0170824_1240823582 | 3300031231 | Forest Soil | QMRTKTTCKAGKPGWSNHSETLVRATHKNLKVRTAVRAGAVKK |
| Ga0170819_106479981 | 3300031469 | Forest Soil | MRTTTNCKSGKGGGGVYNHNETLVRAARKNLKIRTAVRAGAIKR |
| Ga0307471_1020686621 | 3300032180 | Hardwood Forest Soil | MRTKSNVKAGGINLGNHNETLVRDNAKNLKVRTNVRAGNKRAAQ |
| Ga0307471_1020686622 | 3300032180 | Hardwood Forest Soil | MRTKSNVKAGGAWQNHNETLVRDIAKNLKVRTNVRAGKKAQ |
| Ga0307471_1023238491 | 3300032180 | Hardwood Forest Soil | MKTKTNCKAGDGFRIAANHSETLVRDSGSRLKVKTALRAGKKAV |
| Ga0307472_1016154961 | 3300032205 | Hardwood Forest Soil | YAGQEDTQMRTKTTCKAGKSAWNNHSETLVRETRKNLKVRTAVRAGALKR |
| ⦗Top⦘ |