NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094428

Metagenome Family F094428

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094428
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 46 residues
Representative Sequence MANLYYNDRLIIAFASLNQSDKQWSAGAEITWKLDGQRRSHSISGL
Number of Associated Samples 100
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 50.00 %
% of genes near scaffold ends (potentially truncated) 99.06 %
% of genes from short scaffolds (< 2000 bps) 91.51 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.057 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(38.679 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.792 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.62%    Coil/Unstructured: 78.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00903Glyoxalase 17.92
PF00596Aldolase_II 11.32
PF08670MEKHLA 3.77
PF00072Response_reg 1.89
PF13531SBP_bac_11 1.89
PF04909Amidohydro_2 1.89
PF01694Rhomboid 1.89
PF12161HsdM_N 0.94
PF01790LGT 0.94
PF02353CMAS 0.94
PF07690MFS_1 0.94
PF00107ADH_zinc_N 0.94
PF03992ABM 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 1.89
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.94
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.94
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.94
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.06 %
UnclassifiedrootN/A0.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886006|SwRhRL3b_contig_2215794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300000550|F24TB_11701402All Organisms → cellular organisms → Bacteria → Proteobacteria1752Open in IMG/M
3300000890|JGI11643J12802_11260604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1436Open in IMG/M
3300000955|JGI1027J12803_101743197All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300001431|F14TB_102753955All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300002124|C687J26631_10328958All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300004009|Ga0055437_10102815All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300004062|Ga0055500_10156342All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300004463|Ga0063356_101364696All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1041Open in IMG/M
3300004480|Ga0062592_100305578All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300005294|Ga0065705_10481257All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005295|Ga0065707_10319569All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300005344|Ga0070661_100511865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium962Open in IMG/M
3300005356|Ga0070674_100265979All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300005364|Ga0070673_100054725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3140Open in IMG/M
3300005444|Ga0070694_100861768All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005444|Ga0070694_101151834All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005553|Ga0066695_10187938All Organisms → cellular organisms → Bacteria → Proteobacteria1294Open in IMG/M
3300005575|Ga0066702_10456485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300005618|Ga0068864_100333255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1428Open in IMG/M
3300005713|Ga0066905_100919529All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005718|Ga0068866_10940277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300005841|Ga0068863_100988001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300005879|Ga0075295_1003745All Organisms → cellular organisms → Bacteria → Proteobacteria1311Open in IMG/M
3300006163|Ga0070715_11100266All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006755|Ga0079222_10043176All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300006806|Ga0079220_11003569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300006846|Ga0075430_101410740All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006852|Ga0075433_11798574All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006853|Ga0075420_100940786All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006865|Ga0073934_10058854All Organisms → cellular organisms → Bacteria3236Open in IMG/M
3300006954|Ga0079219_10162950All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009081|Ga0105098_10494401All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300009094|Ga0111539_10727997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1155Open in IMG/M
3300009100|Ga0075418_10130232All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300009100|Ga0075418_10762744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1044Open in IMG/M
3300009137|Ga0066709_101126085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1154Open in IMG/M
3300009156|Ga0111538_11648915All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300009167|Ga0113563_10741747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1106Open in IMG/M
3300009792|Ga0126374_10514232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium866Open in IMG/M
3300010046|Ga0126384_10053480All Organisms → cellular organisms → Bacteria2796Open in IMG/M
3300010048|Ga0126373_10728340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1051Open in IMG/M
3300010360|Ga0126372_10550534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1096Open in IMG/M
3300010360|Ga0126372_10615195All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300010362|Ga0126377_10885676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium955Open in IMG/M
3300010366|Ga0126379_10836103All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300010375|Ga0105239_10268524All Organisms → cellular organisms → Bacteria1918Open in IMG/M
3300010375|Ga0105239_12632605All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300010397|Ga0134124_10240447All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300010398|Ga0126383_10821750All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300010398|Ga0126383_12037860All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300011119|Ga0105246_10414302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300011434|Ga0137464_1282162All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300011437|Ga0137429_1115333All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300012205|Ga0137362_10755474All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012498|Ga0157345_1027047All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300012532|Ga0137373_10616108All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300012915|Ga0157302_10056442All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300014320|Ga0075342_1019507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1533Open in IMG/M
3300014326|Ga0157380_12660368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300014876|Ga0180064_1106420All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300015254|Ga0180089_1091056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300015374|Ga0132255_105941626All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300016404|Ga0182037_11011445All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300016422|Ga0182039_10428477All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300018031|Ga0184634_10283481All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300018059|Ga0184615_10169020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1233Open in IMG/M
3300018063|Ga0184637_10310383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium954Open in IMG/M
3300018077|Ga0184633_10317676All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300018077|Ga0184633_10540956All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300018082|Ga0184639_10438856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria670Open in IMG/M
3300018084|Ga0184629_10108244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1368Open in IMG/M
3300018422|Ga0190265_11867740All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300018432|Ga0190275_12509481All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300018469|Ga0190270_10662281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1029Open in IMG/M
3300019377|Ga0190264_10503460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria829Open in IMG/M
3300019879|Ga0193723_1073139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium988Open in IMG/M
3300020003|Ga0193739_1124495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300020018|Ga0193721_1019597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1783Open in IMG/M
3300025165|Ga0209108_10115218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1438Open in IMG/M
3300025312|Ga0209321_10369175All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025319|Ga0209520_10300465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria985Open in IMG/M
3300025537|Ga0210061_1062133All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300025913|Ga0207695_11626134Not Available527Open in IMG/M
3300025923|Ga0207681_10692590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium847Open in IMG/M
3300025972|Ga0207668_11136224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria701Open in IMG/M
3300026118|Ga0207675_101803408All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026334|Ga0209377_1245030All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300027523|Ga0208890_1035273All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300027665|Ga0209983_1005614All Organisms → cellular organisms → Bacteria2589Open in IMG/M
3300027787|Ga0209074_10044334All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300027909|Ga0209382_10078127All Organisms → cellular organisms → Bacteria3903Open in IMG/M
3300027956|Ga0209820_1060364All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300028381|Ga0268264_12096240All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300031184|Ga0307499_10036958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1140Open in IMG/M
3300031231|Ga0170824_107516139All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300031824|Ga0307413_10054564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2426Open in IMG/M
3300031903|Ga0307407_10907819All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031912|Ga0306921_10102682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3315Open in IMG/M
3300031954|Ga0306926_10623674All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300031965|Ga0326597_11948406All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031995|Ga0307409_101513884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria698Open in IMG/M
3300032174|Ga0307470_11116391All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300032180|Ga0307471_103025002All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033419|Ga0316601_102631408All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300034148|Ga0364927_0258390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.72%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.94%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886006Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL3b_0151.000001302162886006Switchgrass RhizosphereMANLYYNDRLIIAFTSLNQSDKKWTAGAEITWKSDG
F24TB_1170140213300000550SoilMANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRDGQR
JGI11643J12802_1126060413300000890SoilMANLYYNDRLIIAFTSLNQSDKQWTVGAEITWRRDGVRQSHT
JGI1027J12803_10174319733300000955SoilMANLYYNDRLIVAYASLNQSTKLWSAGAEITWKCDDR
F14TB_10275395513300001431SoilMANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRDGQRYSHSI
C687J26631_1032895813300002124SoilMANLYYNDRLIIAFASQNQSDKQWTAGAEITWKHDGQRRAHSIGGLTDRFK
Ga0055437_1010281513300004009Natural And Restored WetlandsMANLYYNDRLIIAFASLNQSDKQWSAGAEITWRSDDGRRSHSIASLADRFGS
Ga0055500_1015634213300004062Natural And Restored WetlandsMANLYYNDRLIVAFVSQNQSDKQWRAGAEITWKQDGQRRSHSIGGLTDRFKTS
Ga0063356_10136469633300004463Arabidopsis Thaliana RhizosphereMANIFYKERLILAFANLNPSDKQWSPGAEITWKSEGQRHSH
Ga0062592_10030557843300004480SoilMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKSSDDAE
Ga0065705_1048125723300005294Switchgrass RhizosphereMANLYYNDRLIIAHASINQSTKVWSAGAEITWKRDGERQSHTLGGLA
Ga0065707_1031956933300005295Switchgrass RhizosphereMANLYYHDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKT
Ga0070661_10051186523300005344Corn RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGG
Ga0070674_10026597913300005356Miscanthus RhizosphereMANLYHNDRLIIAFASLNQSDKRWSAGAEITWKVDSQRRSHSISGLSDRFKTSTD
Ga0070673_10005472513300005364Switchgrass RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIG
Ga0070694_10086176823300005444Corn, Switchgrass And Miscanthus RhizosphereVLSAVANIYHNERLIIAYASMNQSSKDWSAGAEITWKHDGQRRSHSIGGLTDRFRSGDDA
Ga0070694_10115183413300005444Corn, Switchgrass And Miscanthus RhizosphereMANLYYNDRLIITFTSLNQSDKQWTAGAEITWRHDGERRS
Ga0066695_1018793833300005553SoilMANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRNGQ
Ga0066702_1045648523300005575SoilMANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEG
Ga0068864_10033325513300005618Switchgrass RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQ
Ga0066905_10091952923300005713Tropical Forest SoilMANLYYNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTL
Ga0068866_1094027713300005718Miscanthus RhizosphereMANLYYRDRLVVAYASNNRSTKDWSAGAEITWRQDGQRFSHTIGGLAD
Ga0068863_10098800113300005841Switchgrass RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSE
Ga0075295_100374513300005879Rice Paddy SoilMANLYYNDRLIIAFTSLNQSDKQWTAGAEITWKQDGARRSHT
Ga0070715_1110026623300006163Corn, Switchgrass And Miscanthus RhizosphereMANLYYNDRLIVAYASLNQSTKLWSAGAEITWKCDDRRQSYTINGLADRFK
Ga0079222_1004317643300006755Agricultural SoilMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGALTDRFKSGDDAE*
Ga0079220_1100356913300006806Agricultural SoilMANVYYKDRLIIAYSSFQQSSKLWSAGAEITWKTGNRRQSHTMAGFTNTFKSSEEAEQ
Ga0075430_10141074013300006846Populus RhizosphereMANLYYNDRLIIAFTSLNQSDKQWTVGAEITWRRDGMRQSHTLGGLTDRFKSSED
Ga0075433_1179857413300006852Populus RhizosphereMANLYYNDRLIIVFASLNQSDKQWSAGAEITWKVDG
Ga0075420_10094078623300006853Populus RhizosphereMANLFYNDRLIIAYAAFQQSSKLWSAGAEITWKTDGQRYSHTIEALPDRFKTAEEAE
Ga0073934_1005885413300006865Hot Spring SedimentVANLYYNERLIIAYASLNPSTQLWSAGAEITWKRDGQRYSHSIGGLADRFKT
Ga0079219_1016295013300006954Agricultural SoilVANLYYSDRLIIAFASFNQSDKQWSAGAEITWKTEGRRHSHTIG
Ga0105098_1049440123300009081Freshwater SedimentMANLYYNDRLIIAHAAFNQSTKLWSPGAEITWKRDGERQSHTIGGLADRFKTAEEA
Ga0111539_1072799713300009094Populus RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQR
Ga0075418_1013023243300009100Populus RhizosphereMANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAE
Ga0075418_1076274423300009100Populus RhizosphereMANIYHNERLIIAYASMNPSSKDWSAGAEITWKHDGQRRSHSIGGLADRFKS
Ga0066709_10112608533300009137Grasslands SoilMANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEGGRCSHSIGGLADRFKTSEDAE
Ga0111538_1164891513300009156Populus RhizosphereMANLYYNNRLIIAHASINQSTKLWSAGAEITWKRDGE
Ga0113563_1074174713300009167Freshwater WetlandsMANLYHNDRLIIAYASMNQSTKDWSAGAEITWKHDGQRFSHSVGGL
Ga0126374_1051423223300009792Tropical Forest SoilMANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQR
Ga0126384_1005348053300010046Tropical Forest SoilMPNLYYKDHLIIAYASLYQSTKLWSPGAEITWKIDGER
Ga0126373_1072834013300010048Tropical Forest SoilMANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQRHSHTIGGLTDRFKSSEDAER
Ga0126372_1055053433300010360Tropical Forest SoilMANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQRHSHTIGGLTDRFKSSEDA
Ga0126372_1061519513300010360Tropical Forest SoilMANLYYNDRLIIAYASLNQSTKLWSAGAEITWKRDGERRSHTIGGL
Ga0126377_1088567623300010362Tropical Forest SoilMANLFYNDRLIIAFASLNQSDKQWSPGAEITWKVDGQRR
Ga0126379_1083610333300010366Tropical Forest SoilMANLYYNDRLIIAYASINQSTKLWSAGAEITWKRD
Ga0105239_1026852413300010375Corn RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTNDDAER
Ga0105239_1263260523300010375Corn RhizosphereMANLYYNDRLIIAFASLNQSDKQWSAGAEITWKLDGQRRSHSISGL
Ga0134124_1024044743300010397Terrestrial SoilMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTNDEA
Ga0126383_1082175033300010398Tropical Forest SoilMANLYHNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTMGGLADRFKTAEEAE
Ga0126383_1203786023300010398Tropical Forest SoilMANLYYNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTMGGLADRFKTAEEAE
Ga0105246_1041430213300011119Miscanthus RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQ
Ga0137464_128216213300011434SoilMANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRF
Ga0137429_111533323300011437SoilVANLYYNDRLIIAFASLNQTDKQWSAGAEITWKADGERRSHS
Ga0137362_1075547433300012205Vadose Zone SoilMANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDDRRQSYTISGLADRFKTSE
Ga0157345_102704713300012498Arabidopsis RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGALPDRFKSGDDA
Ga0137373_1061610823300012532Vadose Zone SoilMANLYYNDRLIITYASLNQSTKTWSPGAEITWTRNGQ
Ga0157302_1005644213300012915SoilMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTI
Ga0075342_101950713300014320Natural And Restored WetlandsMANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRFSHSVGGLGDR
Ga0157380_1266036823300014326Switchgrass RhizosphereMANLYYRDRLVVAYASNNRSTKDWSAGAEITWRQDGQRFSHTIGGLADRFKSSEDAE
Ga0180064_110642023300014876SoilMANLYHNDRLIVAYASINQSTKDWSAGAEITWKRDGQRFSHSVGGLTDRFK
Ga0180089_109105623300015254SoilMANLYYNDRLIIAHASLNRSDKTWSAGAEITWKQDDQRRSRFCRSYSR
Ga0132255_10594162613300015374Arabidopsis RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGL
Ga0182037_1101144533300016404SoilMANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDD
Ga0182039_1042847713300016422SoilMANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDDRRQSHTISGLADRFKTSE
Ga0184634_1028348123300018031Groundwater SedimentMANLYYNDRLVIAFASQNQSDKQWIAGAEITWKQDGHRRTHS
Ga0184615_1016902013300018059Groundwater SedimentMANLYYNDRLIIAHASLNQSDKTWSAGAEITWKRDDQRRSHTIGGLTDKFKTSEDAEK
Ga0184637_1031038333300018063Groundwater SedimentMANLYYNDRLIIAFASQNQSDKQWNAGAAITWSRDGRRRSHSI
Ga0184633_1031767613300018077Groundwater SedimentVANLYHNDRLIIAFASLNQSDKQWSAGAEITWKAEGERRSHSIA
Ga0184633_1054095613300018077Groundwater SedimentMANLYHNDRLIIAFASLNQSDKQWSAGAEITWKVDGQRRSHSISGLSDR
Ga0184639_1043885613300018082Groundwater SedimentMANLYYNDRLIIAFASLNQSDKQWSAGAEITWKAEGERRS
Ga0184629_1010824413300018084Groundwater SedimentMANLYYNHRLIIAFASLSQSDKQWTAGAEITWTQDGQRHSHSIGGLTDRFKT
Ga0190265_1186774013300018422SoilMANLYYNDRLIIAFASLNQSDKQWSAGAEITWRQDGQRHSHSLSGL
Ga0190275_1250948113300018432SoilMANLFYNDRLIIAYTSFQQSSKLWTAGAEITWKSDDQRYSHTIDALPD
Ga0190270_1066228123300018469SoilMANLYHNDRLIVAYASINQSTKDWSAGAEITWKRDGQRFSHSVGGLTDRFKSS
Ga0190264_1050346013300019377SoilMANLYHNDRLIVAYASMNQSTKDWSAGAEITWKQDGQRFSHSVGGLA
Ga0193723_107313913300019879SoilMANLYHNDRLIIAFASLNQSDKRWSAGAEISWKVDGQRRSHSISGLSDRFKTSTD
Ga0193739_112449513300020003SoilMANLYYNDRLIIAHASLNRSDKTWSAGAEITWKQDDQRCSYSIGGLT
Ga0193721_101959753300020018SoilMANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEGGRCSHS
Ga0209108_1011521833300025165SoilMANLYYNDRLIIAFASQNQSDKQWSAGAEITWSREDWRHSHTIGGLADQ
Ga0209321_1036917513300025312SoilMANLYYNDRLIIAFASQNQSDKQWTVGAEITWKQDGQRRSHSIGGMADRFKT
Ga0209520_1030046513300025319SoilMANLYYNDRLIIAFASQIQIQSDKQWSAGVEITWSREGRRRSHTI
Ga0210061_106213313300025537Natural And Restored WetlandsMFIIPARMANLYYNDRLIIAFTSLNQSDKQWTAGA
Ga0207695_1162613423300025913Corn RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRH
Ga0207681_1069259013300025923Switchgrass RhizosphereMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKSSDD
Ga0207668_1113622423300025972Switchgrass RhizosphereMANLYYNDRLIIAFASLNQSDKRWSAGAEISWKLDGQRRSHSISGLS
Ga0207675_10180340813300026118Switchgrass RhizosphereMANLYYNDRLIITFTSLNQSDKQWTAGAEITWRHDGERRSY
Ga0209377_124503023300026334SoilMANLYYNDRLIIAYASINQSTKLWSPGAEISWKRDGQRHSHTIGGLADRFK
Ga0208890_103527323300027523SoilMANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGER
Ga0209983_100561433300027665Arabidopsis Thaliana RhizosphereMANLYYNDRLIIAFTSLNQSDKQWTAGAEITWKLDGARQSHTIGGL
Ga0209074_1004433433300027787Agricultural SoilMANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGAL
Ga0209382_1007812763300027909Populus RhizosphereMANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAEEAER
Ga0209820_106036413300027956Freshwater SedimentMANLYYNDRLIIAHAAFNQSTKLWSPGAEITWKRDGERQSHTI
Ga0268264_1209624013300028381Switchgrass RhizosphereMANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTN
Ga0307499_1003695813300031184SoilMANLYYNDRLIIAFASLNQSDKQWSGGAEITWKVDGQRR
Ga0170824_10751613913300031231Forest SoilMANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAEEAEGIV
Ga0307413_1005456413300031824RhizosphereMANLYHNDRLIIAYASLNQTTKDWSAGAEITWKRDGQRFSHSVG
Ga0307407_1090781913300031903RhizosphereMANLFYNDRLIIAYAAFQQSSKLWSAGAEITWKIDGQRQSHTIDALPDRFKTA
Ga0306921_1010268253300031912SoilMANLYYKERLIVAFVNLNQSDKQWSPGAEITWKSHGQRHS
Ga0306926_1062367433300031954SoilMANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCD
Ga0326597_1194840623300031965SoilMANFYYNDRLIIAFASQNQSDKQWRAGAEITWSREGRRHSHT
Ga0307409_10151388423300031995RhizosphereMANLYHNDRLIIAYASLNQSTKDWCAGAEITWTRDGQRFSH
Ga0307470_1111639123300032174Hardwood Forest SoilMANLYYNDRLIIAHASVNQSTKLWSAGAEITWKRDGERQSHTLG
Ga0307471_10302500213300032180Hardwood Forest SoilMANLYYNDRLIIAHASVNQSTKLWSAGAEIAWKRDGERQSHTLGGL
Ga0316601_10263140813300033419SoilMANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRFSHTLGGLGDRFKSSGDAER
Ga0364927_0258390_2_1243300034148SedimentMANLYHNDRLIIAYAAMNQSTKTWSPGAEITWKSDGERHTH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.