Basic Information | |
---|---|
Family ID | F094428 |
Family Type | Metagenome |
Number of Sequences | 106 |
Average Sequence Length | 46 residues |
Representative Sequence | MANLYYNDRLIIAFASLNQSDKQWSAGAEITWKLDGQRRSHSISGL |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 50.00 % |
% of genes near scaffold ends (potentially truncated) | 99.06 % |
% of genes from short scaffolds (< 2000 bps) | 91.51 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.057 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.434 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.679 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.792 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.62% Coil/Unstructured: 78.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 17.92 |
PF00596 | Aldolase_II | 11.32 |
PF08670 | MEKHLA | 3.77 |
PF00072 | Response_reg | 1.89 |
PF13531 | SBP_bac_11 | 1.89 |
PF04909 | Amidohydro_2 | 1.89 |
PF01694 | Rhomboid | 1.89 |
PF12161 | HsdM_N | 0.94 |
PF01790 | LGT | 0.94 |
PF02353 | CMAS | 0.94 |
PF07690 | MFS_1 | 0.94 |
PF00107 | ADH_zinc_N | 0.94 |
PF03992 | ABM | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.94 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.94 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.06 % |
Unclassified | root | N/A | 0.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886006|SwRhRL3b_contig_2215794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
3300000550|F24TB_11701402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1752 | Open in IMG/M |
3300000890|JGI11643J12802_11260604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1436 | Open in IMG/M |
3300000955|JGI1027J12803_101743197 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300001431|F14TB_102753955 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300002124|C687J26631_10328958 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300004009|Ga0055437_10102815 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300004062|Ga0055500_10156342 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300004463|Ga0063356_101364696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1041 | Open in IMG/M |
3300004480|Ga0062592_100305578 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300005294|Ga0065705_10481257 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300005295|Ga0065707_10319569 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300005344|Ga0070661_100511865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
3300005356|Ga0070674_100265979 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300005364|Ga0070673_100054725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3140 | Open in IMG/M |
3300005444|Ga0070694_100861768 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300005444|Ga0070694_101151834 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005553|Ga0066695_10187938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
3300005575|Ga0066702_10456485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
3300005618|Ga0068864_100333255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1428 | Open in IMG/M |
3300005713|Ga0066905_100919529 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300005718|Ga0068866_10940277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300005841|Ga0068863_100988001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300005879|Ga0075295_1003745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
3300006163|Ga0070715_11100266 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006755|Ga0079222_10043176 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
3300006806|Ga0079220_11003569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300006846|Ga0075430_101410740 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300006852|Ga0075433_11798574 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300006853|Ga0075420_100940786 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300006865|Ga0073934_10058854 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
3300006954|Ga0079219_10162950 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300009081|Ga0105098_10494401 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300009094|Ga0111539_10727997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1155 | Open in IMG/M |
3300009100|Ga0075418_10130232 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300009100|Ga0075418_10762744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1044 | Open in IMG/M |
3300009137|Ga0066709_101126085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1154 | Open in IMG/M |
3300009156|Ga0111538_11648915 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300009167|Ga0113563_10741747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1106 | Open in IMG/M |
3300009792|Ga0126374_10514232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
3300010046|Ga0126384_10053480 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
3300010048|Ga0126373_10728340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1051 | Open in IMG/M |
3300010360|Ga0126372_10550534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1096 | Open in IMG/M |
3300010360|Ga0126372_10615195 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300010362|Ga0126377_10885676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 955 | Open in IMG/M |
3300010366|Ga0126379_10836103 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300010375|Ga0105239_10268524 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
3300010375|Ga0105239_12632605 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300010397|Ga0134124_10240447 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300010398|Ga0126383_10821750 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300010398|Ga0126383_12037860 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300011119|Ga0105246_10414302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1122 | Open in IMG/M |
3300011434|Ga0137464_1282162 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300011437|Ga0137429_1115333 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300012205|Ga0137362_10755474 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012498|Ga0157345_1027047 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300012532|Ga0137373_10616108 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300012915|Ga0157302_10056442 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300014320|Ga0075342_1019507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1533 | Open in IMG/M |
3300014326|Ga0157380_12660368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
3300014876|Ga0180064_1106420 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300015254|Ga0180089_1091056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300015374|Ga0132255_105941626 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300016404|Ga0182037_11011445 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300016422|Ga0182039_10428477 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300018031|Ga0184634_10283481 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300018059|Ga0184615_10169020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1233 | Open in IMG/M |
3300018063|Ga0184637_10310383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 954 | Open in IMG/M |
3300018077|Ga0184633_10317676 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300018077|Ga0184633_10540956 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300018082|Ga0184639_10438856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 670 | Open in IMG/M |
3300018084|Ga0184629_10108244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1368 | Open in IMG/M |
3300018422|Ga0190265_11867740 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300018432|Ga0190275_12509481 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300018469|Ga0190270_10662281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1029 | Open in IMG/M |
3300019377|Ga0190264_10503460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 829 | Open in IMG/M |
3300019879|Ga0193723_1073139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 988 | Open in IMG/M |
3300020003|Ga0193739_1124495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
3300020018|Ga0193721_1019597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1783 | Open in IMG/M |
3300025165|Ga0209108_10115218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1438 | Open in IMG/M |
3300025312|Ga0209321_10369175 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300025319|Ga0209520_10300465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 985 | Open in IMG/M |
3300025537|Ga0210061_1062133 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300025913|Ga0207695_11626134 | Not Available | 527 | Open in IMG/M |
3300025923|Ga0207681_10692590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 847 | Open in IMG/M |
3300025972|Ga0207668_11136224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 701 | Open in IMG/M |
3300026118|Ga0207675_101803408 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300026334|Ga0209377_1245030 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300027523|Ga0208890_1035273 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300027665|Ga0209983_1005614 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
3300027787|Ga0209074_10044334 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300027909|Ga0209382_10078127 | All Organisms → cellular organisms → Bacteria | 3903 | Open in IMG/M |
3300027956|Ga0209820_1060364 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300028381|Ga0268264_12096240 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300031184|Ga0307499_10036958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1140 | Open in IMG/M |
3300031231|Ga0170824_107516139 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300031824|Ga0307413_10054564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2426 | Open in IMG/M |
3300031903|Ga0307407_10907819 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300031912|Ga0306921_10102682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3315 | Open in IMG/M |
3300031954|Ga0306926_10623674 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300031965|Ga0326597_11948406 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031995|Ga0307409_101513884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 698 | Open in IMG/M |
3300032174|Ga0307470_11116391 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300032180|Ga0307471_103025002 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300033419|Ga0316601_102631408 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300034148|Ga0364927_0258390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.55% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.77% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.89% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.89% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.94% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL3b_0151.00000130 | 2162886006 | Switchgrass Rhizosphere | MANLYYNDRLIIAFTSLNQSDKKWTAGAEITWKSDG |
F24TB_117014021 | 3300000550 | Soil | MANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRDGQR |
JGI11643J12802_112606041 | 3300000890 | Soil | MANLYYNDRLIIAFTSLNQSDKQWTVGAEITWRRDGVRQSHT |
JGI1027J12803_1017431973 | 3300000955 | Soil | MANLYYNDRLIVAYASLNQSTKLWSAGAEITWKCDDR |
F14TB_1027539551 | 3300001431 | Soil | MANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRDGQRYSHSI |
C687J26631_103289581 | 3300002124 | Soil | MANLYYNDRLIIAFASQNQSDKQWTAGAEITWKHDGQRRAHSIGGLTDRFK |
Ga0055437_101028151 | 3300004009 | Natural And Restored Wetlands | MANLYYNDRLIIAFASLNQSDKQWSAGAEITWRSDDGRRSHSIASLADRFGS |
Ga0055500_101563421 | 3300004062 | Natural And Restored Wetlands | MANLYYNDRLIVAFVSQNQSDKQWRAGAEITWKQDGQRRSHSIGGLTDRFKTS |
Ga0063356_1013646963 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MANIFYKERLILAFANLNPSDKQWSPGAEITWKSEGQRHSH |
Ga0062592_1003055784 | 3300004480 | Soil | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKSSDDAE |
Ga0065705_104812572 | 3300005294 | Switchgrass Rhizosphere | MANLYYNDRLIIAHASINQSTKVWSAGAEITWKRDGERQSHTLGGLA |
Ga0065707_103195693 | 3300005295 | Switchgrass Rhizosphere | MANLYYHDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKT |
Ga0070661_1005118652 | 3300005344 | Corn Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGG |
Ga0070674_1002659791 | 3300005356 | Miscanthus Rhizosphere | MANLYHNDRLIIAFASLNQSDKRWSAGAEITWKVDSQRRSHSISGLSDRFKTSTD |
Ga0070673_1000547251 | 3300005364 | Switchgrass Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIG |
Ga0070694_1008617682 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSAVANIYHNERLIIAYASMNQSSKDWSAGAEITWKHDGQRRSHSIGGLTDRFRSGDDA |
Ga0070694_1011518341 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MANLYYNDRLIITFTSLNQSDKQWTAGAEITWRHDGERRS |
Ga0066695_101879383 | 3300005553 | Soil | MANLYYNDRLIIAYASLNQSTKTWSPGAEITWTRNGQ |
Ga0066702_104564852 | 3300005575 | Soil | MANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEG |
Ga0068864_1003332551 | 3300005618 | Switchgrass Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQ |
Ga0066905_1009195292 | 3300005713 | Tropical Forest Soil | MANLYYNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTL |
Ga0068866_109402771 | 3300005718 | Miscanthus Rhizosphere | MANLYYRDRLVVAYASNNRSTKDWSAGAEITWRQDGQRFSHTIGGLAD |
Ga0068863_1009880011 | 3300005841 | Switchgrass Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSE |
Ga0075295_10037451 | 3300005879 | Rice Paddy Soil | MANLYYNDRLIIAFTSLNQSDKQWTAGAEITWKQDGARRSHT |
Ga0070715_111002662 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MANLYYNDRLIVAYASLNQSTKLWSAGAEITWKCDDRRQSYTINGLADRFK |
Ga0079222_100431764 | 3300006755 | Agricultural Soil | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGALTDRFKSGDDAE* |
Ga0079220_110035691 | 3300006806 | Agricultural Soil | MANVYYKDRLIIAYSSFQQSSKLWSAGAEITWKTGNRRQSHTMAGFTNTFKSSEEAEQ |
Ga0075430_1014107401 | 3300006846 | Populus Rhizosphere | MANLYYNDRLIIAFTSLNQSDKQWTVGAEITWRRDGMRQSHTLGGLTDRFKSSED |
Ga0075433_117985741 | 3300006852 | Populus Rhizosphere | MANLYYNDRLIIVFASLNQSDKQWSAGAEITWKVDG |
Ga0075420_1009407862 | 3300006853 | Populus Rhizosphere | MANLFYNDRLIIAYAAFQQSSKLWSAGAEITWKTDGQRYSHTIEALPDRFKTAEEAE |
Ga0073934_100588541 | 3300006865 | Hot Spring Sediment | VANLYYNERLIIAYASLNPSTQLWSAGAEITWKRDGQRYSHSIGGLADRFKT |
Ga0079219_101629501 | 3300006954 | Agricultural Soil | VANLYYSDRLIIAFASFNQSDKQWSAGAEITWKTEGRRHSHTIG |
Ga0105098_104944012 | 3300009081 | Freshwater Sediment | MANLYYNDRLIIAHAAFNQSTKLWSPGAEITWKRDGERQSHTIGGLADRFKTAEEA |
Ga0111539_107279971 | 3300009094 | Populus Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQR |
Ga0075418_101302324 | 3300009100 | Populus Rhizosphere | MANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAE |
Ga0075418_107627442 | 3300009100 | Populus Rhizosphere | MANIYHNERLIIAYASMNPSSKDWSAGAEITWKHDGQRRSHSIGGLADRFKS |
Ga0066709_1011260853 | 3300009137 | Grasslands Soil | MANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEGGRCSHSIGGLADRFKTSEDAE |
Ga0111538_116489151 | 3300009156 | Populus Rhizosphere | MANLYYNNRLIIAHASINQSTKLWSAGAEITWKRDGE |
Ga0113563_107417471 | 3300009167 | Freshwater Wetlands | MANLYHNDRLIIAYASMNQSTKDWSAGAEITWKHDGQRFSHSVGGL |
Ga0126374_105142322 | 3300009792 | Tropical Forest Soil | MANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQR |
Ga0126384_100534805 | 3300010046 | Tropical Forest Soil | MPNLYYKDHLIIAYASLYQSTKLWSPGAEITWKIDGER |
Ga0126373_107283401 | 3300010048 | Tropical Forest Soil | MANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQRHSHTIGGLTDRFKSSEDAER |
Ga0126372_105505343 | 3300010360 | Tropical Forest Soil | MANLYYKERLIVAFANLNQSDKQWSPGAEITWKSHGQRHSHTIGGLTDRFKSSEDA |
Ga0126372_106151951 | 3300010360 | Tropical Forest Soil | MANLYYNDRLIIAYASLNQSTKLWSAGAEITWKRDGERRSHTIGGL |
Ga0126377_108856762 | 3300010362 | Tropical Forest Soil | MANLFYNDRLIIAFASLNQSDKQWSPGAEITWKVDGQRR |
Ga0126379_108361033 | 3300010366 | Tropical Forest Soil | MANLYYNDRLIIAYASINQSTKLWSAGAEITWKRD |
Ga0105239_102685241 | 3300010375 | Corn Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTNDDAER |
Ga0105239_126326052 | 3300010375 | Corn Rhizosphere | MANLYYNDRLIIAFASLNQSDKQWSAGAEITWKLDGQRRSHSISGL |
Ga0134124_102404474 | 3300010397 | Terrestrial Soil | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTNDEA |
Ga0126383_108217503 | 3300010398 | Tropical Forest Soil | MANLYHNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTMGGLADRFKTAEEAE |
Ga0126383_120378602 | 3300010398 | Tropical Forest Soil | MANLYYNDRLIIAYASINQSTKLWSAGAEITWKRDGERQSHTMGGLADRFKTAEEAE |
Ga0105246_104143021 | 3300011119 | Miscanthus Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQ |
Ga0137464_12821621 | 3300011434 | Soil | MANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRF |
Ga0137429_11153332 | 3300011437 | Soil | VANLYYNDRLIIAFASLNQTDKQWSAGAEITWKADGERRSHS |
Ga0137362_107554743 | 3300012205 | Vadose Zone Soil | MANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDDRRQSYTISGLADRFKTSE |
Ga0157345_10270471 | 3300012498 | Arabidopsis Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGALPDRFKSGDDA |
Ga0137373_106161082 | 3300012532 | Vadose Zone Soil | MANLYYNDRLIITYASLNQSTKTWSPGAEITWTRNGQ |
Ga0157302_100564421 | 3300012915 | Soil | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTI |
Ga0075342_10195071 | 3300014320 | Natural And Restored Wetlands | MANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRFSHSVGGLGDR |
Ga0157380_126603682 | 3300014326 | Switchgrass Rhizosphere | MANLYYRDRLVVAYASNNRSTKDWSAGAEITWRQDGQRFSHTIGGLADRFKSSEDAE |
Ga0180064_11064202 | 3300014876 | Soil | MANLYHNDRLIVAYASINQSTKDWSAGAEITWKRDGQRFSHSVGGLTDRFK |
Ga0180089_10910562 | 3300015254 | Soil | MANLYYNDRLIIAHASLNRSDKTWSAGAEITWKQDDQRRSRFCRSYSR |
Ga0132255_1059416261 | 3300015374 | Arabidopsis Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGL |
Ga0182037_110114453 | 3300016404 | Soil | MANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDD |
Ga0182039_104284771 | 3300016422 | Soil | MANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCDDRRQSHTISGLADRFKTSE |
Ga0184634_102834812 | 3300018031 | Groundwater Sediment | MANLYYNDRLVIAFASQNQSDKQWIAGAEITWKQDGHRRTHS |
Ga0184615_101690201 | 3300018059 | Groundwater Sediment | MANLYYNDRLIIAHASLNQSDKTWSAGAEITWKRDDQRRSHTIGGLTDKFKTSEDAEK |
Ga0184637_103103833 | 3300018063 | Groundwater Sediment | MANLYYNDRLIIAFASQNQSDKQWNAGAAITWSRDGRRRSHSI |
Ga0184633_103176761 | 3300018077 | Groundwater Sediment | VANLYHNDRLIIAFASLNQSDKQWSAGAEITWKAEGERRSHSIA |
Ga0184633_105409561 | 3300018077 | Groundwater Sediment | MANLYHNDRLIIAFASLNQSDKQWSAGAEITWKVDGQRRSHSISGLSDR |
Ga0184639_104388561 | 3300018082 | Groundwater Sediment | MANLYYNDRLIIAFASLNQSDKQWSAGAEITWKAEGERRS |
Ga0184629_101082441 | 3300018084 | Groundwater Sediment | MANLYYNHRLIIAFASLSQSDKQWTAGAEITWTQDGQRHSHSIGGLTDRFKT |
Ga0190265_118677401 | 3300018422 | Soil | MANLYYNDRLIIAFASLNQSDKQWSAGAEITWRQDGQRHSHSLSGL |
Ga0190275_125094811 | 3300018432 | Soil | MANLFYNDRLIIAYTSFQQSSKLWTAGAEITWKSDDQRYSHTIDALPD |
Ga0190270_106622812 | 3300018469 | Soil | MANLYHNDRLIVAYASINQSTKDWSAGAEITWKRDGQRFSHSVGGLTDRFKSS |
Ga0190264_105034601 | 3300019377 | Soil | MANLYHNDRLIVAYASMNQSTKDWSAGAEITWKQDGQRFSHSVGGLA |
Ga0193723_10731391 | 3300019879 | Soil | MANLYHNDRLIIAFASLNQSDKRWSAGAEISWKVDGQRRSHSISGLSDRFKTSTD |
Ga0193739_11244951 | 3300020003 | Soil | MANLYYNDRLIIAHASLNRSDKTWSAGAEITWKQDDQRCSYSIGGLT |
Ga0193721_10195975 | 3300020018 | Soil | MANLYYNDRLIIAFTSLNQSDKQWSAGAEITWKSEGGRCSHS |
Ga0209108_101152183 | 3300025165 | Soil | MANLYYNDRLIIAFASQNQSDKQWSAGAEITWSREDWRHSHTIGGLADQ |
Ga0209321_103691751 | 3300025312 | Soil | MANLYYNDRLIIAFASQNQSDKQWTVGAEITWKQDGQRRSHSIGGMADRFKT |
Ga0209520_103004651 | 3300025319 | Soil | MANLYYNDRLIIAFASQIQIQSDKQWSAGVEITWSREGRRRSHTI |
Ga0210061_10621331 | 3300025537 | Natural And Restored Wetlands | MFIIPARMANLYYNDRLIIAFTSLNQSDKQWTAGA |
Ga0207695_116261342 | 3300025913 | Corn Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRH |
Ga0207681_106925901 | 3300025923 | Switchgrass Rhizosphere | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKSSDD |
Ga0207668_111362242 | 3300025972 | Switchgrass Rhizosphere | MANLYYNDRLIIAFASLNQSDKRWSAGAEISWKLDGQRRSHSISGLS |
Ga0207675_1018034081 | 3300026118 | Switchgrass Rhizosphere | MANLYYNDRLIITFTSLNQSDKQWTAGAEITWRHDGERRSY |
Ga0209377_12450302 | 3300026334 | Soil | MANLYYNDRLIIAYASINQSTKLWSPGAEISWKRDGQRHSHTIGGLADRFK |
Ga0208890_10352732 | 3300027523 | Soil | MANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGER |
Ga0209983_10056143 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MANLYYNDRLIIAFTSLNQSDKQWTAGAEITWKLDGARQSHTIGGL |
Ga0209074_100443343 | 3300027787 | Agricultural Soil | MANVFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGAL |
Ga0209382_100781276 | 3300027909 | Populus Rhizosphere | MANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAEEAER |
Ga0209820_10603641 | 3300027956 | Freshwater Sediment | MANLYYNDRLIIAHAAFNQSTKLWSPGAEITWKRDGERQSHTI |
Ga0268264_120962401 | 3300028381 | Switchgrass Rhizosphere | MANIFYKERLIVAFANLNPSDKQWSPGAEITWKSEGQRHSHTIGGLTDRFKTN |
Ga0307499_100369581 | 3300031184 | Soil | MANLYYNDRLIIAFASLNQSDKQWSGGAEITWKVDGQRR |
Ga0170824_1075161391 | 3300031231 | Forest Soil | MANLYYNDRLIIAHASINQSTKLWSAGAEITWKRDGERQSHTLGGLADRFKTAEEAEGIV |
Ga0307413_100545641 | 3300031824 | Rhizosphere | MANLYHNDRLIIAYASLNQTTKDWSAGAEITWKRDGQRFSHSVG |
Ga0307407_109078191 | 3300031903 | Rhizosphere | MANLFYNDRLIIAYAAFQQSSKLWSAGAEITWKIDGQRQSHTIDALPDRFKTA |
Ga0306921_101026825 | 3300031912 | Soil | MANLYYKERLIVAFVNLNQSDKQWSPGAEITWKSHGQRHS |
Ga0306926_106236743 | 3300031954 | Soil | MANLYYNDRLIVAYASLNQSTKLWSPGAEITWKCD |
Ga0326597_119484062 | 3300031965 | Soil | MANFYYNDRLIIAFASQNQSDKQWRAGAEITWSREGRRHSHT |
Ga0307409_1015138842 | 3300031995 | Rhizosphere | MANLYHNDRLIIAYASLNQSTKDWCAGAEITWTRDGQRFSH |
Ga0307470_111163912 | 3300032174 | Hardwood Forest Soil | MANLYYNDRLIIAHASVNQSTKLWSAGAEITWKRDGERQSHTLG |
Ga0307471_1030250021 | 3300032180 | Hardwood Forest Soil | MANLYYNDRLIIAHASVNQSTKLWSAGAEIAWKRDGERQSHTLGGL |
Ga0316601_1026314081 | 3300033419 | Soil | MANLYHNDRLIIAYASMNQSTKDWSAGAEITWKRDGQRFSHTLGGLGDRFKSSGDAER |
Ga0364927_0258390_2_124 | 3300034148 | Sediment | MANLYHNDRLIIAYAAMNQSTKTWSPGAEITWKSDGERHTH |
⦗Top⦘ |