NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094385

Metagenome / Metatranscriptome Family F094385

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094385
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 165 residues
Representative Sequence MFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Number of Associated Samples 90
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 24.53 %
% of genes near scaffold ends (potentially truncated) 52.83 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.057 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.415 % of family members)
Environment Ontology (ENVO) Unclassified
(70.755 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(56.604 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 63.64%    β-sheet: 0.00%    Coil/Unstructured: 36.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005941|Ga0070743_10045336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1503Open in IMG/M
3300005942|Ga0070742_10105721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum778Open in IMG/M
3300006165|Ga0075443_10033360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1720Open in IMG/M
3300007554|Ga0102820_1020741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1621Open in IMG/M
3300007623|Ga0102948_1282834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300007658|Ga0102898_1062753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300007667|Ga0102910_1166597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300007706|Ga0102899_1031636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1246Open in IMG/M
3300009028|Ga0103708_100286776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300009057|Ga0102892_1064101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300009071|Ga0115566_10227188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1128Open in IMG/M
3300009265|Ga0103873_1003599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1609Open in IMG/M
3300009432|Ga0115005_10271021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1332Open in IMG/M
3300009432|Ga0115005_11176953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300009434|Ga0115562_1075939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1395Open in IMG/M
3300009434|Ga0115562_1226582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300009495|Ga0115571_1191885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum839Open in IMG/M
3300009507|Ga0115572_10267395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum975Open in IMG/M
3300009538|Ga0129287_10097720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1244Open in IMG/M
3300009606|Ga0115102_10600265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300009677|Ga0115104_10672318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300010354|Ga0129333_11347137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300010368|Ga0129324_10178238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum872Open in IMG/M
3300012408|Ga0138265_1265006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300012412|Ga0138266_1297120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1642Open in IMG/M
3300012413|Ga0138258_1333218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300012415|Ga0138263_1017163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1657Open in IMG/M
3300012417|Ga0138262_1047478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300012419|Ga0138260_10079415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300012782|Ga0138268_1207499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300012782|Ga0138268_1323486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1613Open in IMG/M
3300018692|Ga0192944_1003594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1589Open in IMG/M
3300018874|Ga0192977_1008495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1674Open in IMG/M
3300019048|Ga0192981_10034510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1709Open in IMG/M
3300019048|Ga0192981_10039099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1640Open in IMG/M
3300019048|Ga0192981_10043154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1587Open in IMG/M
3300019095|Ga0188866_1036133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300020074|Ga0194113_10726565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300020200|Ga0194121_10381404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300021371|Ga0213863_10291437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300021424|Ga0194117_10287887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300021872|Ga0063132_108343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1703Open in IMG/M
3300021887|Ga0063105_1036467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1478Open in IMG/M
3300021941|Ga0063102_1020187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1420Open in IMG/M
3300021941|Ga0063102_1030037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1377Open in IMG/M
3300021962|Ga0222713_10350538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum923Open in IMG/M
3300022926|Ga0255753_1306350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300024239|Ga0247724_1016728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1070Open in IMG/M
3300024346|Ga0244775_10208613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1637Open in IMG/M
3300025640|Ga0209198_1040432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1831Open in IMG/M
3300025887|Ga0208544_10312924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300025890|Ga0209631_10087166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1842Open in IMG/M
3300025890|Ga0209631_10087372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1839Open in IMG/M
3300025890|Ga0209631_10234499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum923Open in IMG/M
3300025897|Ga0209425_10219548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1001Open in IMG/M
3300026447|Ga0247607_1097078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300026448|Ga0247594_1006893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1686Open in IMG/M
3300026448|Ga0247594_1030603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum906Open in IMG/M
3300027190|Ga0208674_1053061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300027243|Ga0208174_1052153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300027771|Ga0209279_10098069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300027791|Ga0209830_10480016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300027849|Ga0209712_10713081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300028137|Ga0256412_1126531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum938Open in IMG/M
3300028671|Ga0257132_1105256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300030671|Ga0307403_10407430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300030699|Ga0307398_10322666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum840Open in IMG/M
3300030699|Ga0307398_10738162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300030702|Ga0307399_10333926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300030709|Ga0307400_10209270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1220Open in IMG/M
3300030709|Ga0307400_10683304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300031036|Ga0073978_1006588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300031579|Ga0308134_1025379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1364Open in IMG/M
3300031729|Ga0307391_10094844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1417Open in IMG/M
3300031735|Ga0307394_10152934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum895Open in IMG/M
3300031738|Ga0307384_10052997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1489Open in IMG/M
3300031738|Ga0307384_10232260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300031738|Ga0307384_10407779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300031738|Ga0307384_10672605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300031739|Ga0307383_10130118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1142Open in IMG/M
3300031739|Ga0307383_10540012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300031742|Ga0307395_10299677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300031743|Ga0307382_10398208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300032463|Ga0314684_10095901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1456Open in IMG/M
3300032463|Ga0314684_10249477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1012Open in IMG/M
3300032470|Ga0314670_10128943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1192Open in IMG/M
3300032481|Ga0314668_10127210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1238Open in IMG/M
3300032491|Ga0314675_10060030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1551Open in IMG/M
3300032517|Ga0314688_10079831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1414Open in IMG/M
3300032518|Ga0314689_10140179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1206Open in IMG/M
3300032519|Ga0314676_10805123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300032520|Ga0314667_10147168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1182Open in IMG/M
3300032540|Ga0314682_10117350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1319Open in IMG/M
3300032617|Ga0314683_10675839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300032650|Ga0314673_10129088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1143Open in IMG/M
3300032711|Ga0314681_10604156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300032713|Ga0314690_10148170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1101Open in IMG/M
3300032723|Ga0314703_10087540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1235Open in IMG/M
3300032724|Ga0314695_1059497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1267Open in IMG/M
3300032729|Ga0314697_10246482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300032730|Ga0314699_10335082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300032733|Ga0314714_10067131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1672Open in IMG/M
3300032743|Ga0314707_10063345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1583Open in IMG/M
3300032750|Ga0314708_10137997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1147Open in IMG/M
3300032751|Ga0314694_10092795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1183Open in IMG/M
3300033572|Ga0307390_10282703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum985Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater20.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.49%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine7.55%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.60%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.66%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.83%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.83%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.94%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.94%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.94%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.94%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.94%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070743_1004533623300005941EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0070742_1010572113300005942EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYDDWTRPDGKNVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0075443_1003336023300006165MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYLLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCIYMDTGNNYGMRYLLPSVMTLAAVLFVFYIA*
Ga0102820_102074113300007554EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0102948_128283413300007623WaterMFFYISGMGSTFFNTEGKGFGIFVYDKVLRLMVPFVLAIFIFLIPRLYFGQPYEDFCRPDGKIENDYWEFQRKTLPTIFSKLSWLWYLPALFIDCIITYPLLALSIRRAKKIPFEAKDDGNIIFLQVAILIIWCYPAIYMDT
Ga0102898_106275313300007658EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTL
Ga0102910_116659713300007667EstuarineMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0102899_103163623300007706EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPNGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0103708_10028677613300009028Ocean WaterGMGATFFNTEGKGFGNFVGNKVLRLLVPFVIAIFIFLIPRLYFGQQYEDFCRPDGKTIEDDYWTFQTKTLQGNIFIKLSWLWYLPALFIDCMLTYPLVAWSIRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNGYGMRYLLPSTLTLAGIMFVFYIAQLMIYTQN
Ga0102892_106410123300009057EstuarineMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFFIAIFVFLIPRLYFGQSYEDFCKPDGKNVEEDYWTFQMKTLPTIGSKLSWLWYLPALFIDCMLTYPLLAWTVRRSRKIPFDQRDDGNIVFLQLAIFVVWCYPCFYMDTGNNYGVRYLLPSNLTLACIIFFFYTFQLLIYTENGDKYALLI
Ga0115566_1022718813300009071Pelagic MarineMFFYISGMGATFFNTEGKGFGNFVLNKVLRLLVPFVVAIFIFLMPRLYFGQPYEEFCRPDGKNIEEDYWQFNQKTLEYNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPVIYMDTGNNYGMRYLLPSVMTLAAIMFVFYVA*
Ga0103873_100359923300009265Surface Ocean WaterMFFYIAGMGATFFNTEGKGFGNFVGNKTLRLIVPFVIAIFIFLIPRLYFGQSYEDFTRPDGKQEDDYWQFQMKTLPTIFSKLSWLWYLPALFIDCMLTYPLLAWSIRRAKKIPFDSRDDGNIVFLQIAIFVIWCYPCFYMDTSYNYGVRYLLPSNLTLACIIFFFYTFQLLIYT*
Ga0115005_1027102123300009432MarineMFFYISGMGATYFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKENMENDYWEFNKLILPGIMSRLSWLWYLPALFVDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDNYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNMWKN*
Ga0115005_1117695313300009432MarineTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYWEFNKLIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIIMLFYVV*
Ga0115562_107593923300009434Pelagic MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTIENNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA*
Ga0115562_122658223300009434Pelagic MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYP
Ga0115571_119188523300009495Pelagic MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNLWKN*
Ga0115572_1026739513300009507Pelagic MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKI
Ga0129287_1009772023300009538Beach Aquifer PorewaterIVAIFLFLIPRLYFGQPYEDWTRPDKKNEEDDYWEFQMKTLPNVLSKLSWLWYLPALFIDCMLTYPLLAWSMRRAHKIPFNSRDDGNIVLLQLGLLIVWCYPAFYLDTDDKYGERFLLPSILTLAIIMMVFYSF*
Ga0115102_1060026523300009606MarineMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVMFVFYIA*
Ga0115104_1067231813300009677MarineMFFYISGIGSTFFNTEGKGFAIFVWDKILRLMIPFVIAIFIFLIPRLYFGQPYEEFCRPDGVMENDYWEFQRKTLPTVLTKLSWLWYLPALFIDCIITYPLLAWSVRRARKIPFNGRDDGNIIFLQLGIFVVWCYPAFYLDTSYNYGVRFLLPSIITLMIIFMIFY
Ga0129333_1134713713300010354Freshwater To Marine Saline GradientVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC*
Ga0129324_1017823813300010368Freshwater To Marine Saline GradientMFFYISGMGSTFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLIPRLYYGQPYEEFCRPDGKHIENDYWEFQKQSLPNIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFEARDDGNIVFLQVAILVVWCYPAIYMDTGNNYGVRYLLPSIAT
Ga0138265_126500613300012408Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVCAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQQIPFNGRDDGNIIFLQLGIFVAWCYPAFYLDTDDDYGQRF
Ga0138266_129712023300012412Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMVPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIMMLFYVAQLSIHTENGAKYAMFMKILGPCGSIALNLWKN*
Ga0138258_133321823300012413Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIIFLQLGIFVAWCYPAFYLDTDDYYGQRFLLP
Ga0138263_101716323300012415Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIIFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIMMLFYVAQLSIHTENGAKYAMFMKILGPCGSIALNLWKN*
Ga0138262_104747813300012417Polar MarineKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQQIPFNGRDDGNIIFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIMMLFYVAQLSIHTENGAKYAMFMKILGPCGSIALNLWKN*
Ga0138260_1007941513300012419Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLP
Ga0138268_120749913300012782Polar MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYLLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCIYMDTGNNY
Ga0138268_132348623300012782Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWDFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIMMLFYVAQLSIHTENGAKYAMFMKILGPCGSIALNLWKN*
Ga0192944_100359413300018692MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSVLTLACIFFFFYTFQLLIHQEGGEKYAMWIKIIGPLGSCALNYWKD
Ga0192977_100849523300018874MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYLLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCIYMDTGNNYGMRYLLPSVMTLAAVLFVFYIA
Ga0192981_1003451023300019048MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQQIPFNGRDDGNIIFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIMMLFYVAQLSIHTENGAKYAMFMKILGPCGSIALNLWKN
Ga0192981_1003909923300019048MarineMFFYISGMGATYFNTEGKGFFLFTWNKITRLLIPFVLAIFIFLIPRLYFGQPYEEWCRPDKVNMESDYWLFVQKIIPGIMSRLSWLWYLPALFVDCMITYPLLAWSIRRAQQIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDNYGQRFLLPSILTLAIIMMLFYVTQLSIHTENGAKYAMFMKILGPCGSIALNLWKN
Ga0192981_1004315423300019048MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFVDCMLTYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMAFYVV
Ga0188866_103613313300019095Freshwater LakeNKVLRLLVPFVVAIFIFLMPRLYFGQPYEEFCRPDGKNIEEDYWQFNQKTLEYNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPVIYMDTGNNYGMRYLLPSVMTLAAIMFVFYVA
Ga0194113_1072656513300020074Freshwater LakeMFFYISGMASTFFNSEGKGFGMFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKFQAKTLPTIFSKLSWLWYLPALFVDCILTYPLLAWTIRRAAKIPFSSRDDVNILLLQVAIFIVWLFPCFYMDTSNDYGVRYLLPSTITLACIFACFYIFQLLIH
Ga0194121_1038140413300020200Freshwater LakeGFGMFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKFQAKTLPTIFSKLSWLWYLPALFVDCILTYPLLAWTIRRAAKIPFSSRDDVNILLLQVAIFIVWCFPCFYMDTSNDYGVRYLLPSTITLACIFACFYIFQLLIH
Ga0213863_1029143713300021371SeawaterMFFYISGMGATFFNTEGKGFFLFTWGKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDGEHMESDYWTFNKLILPSIFSKLSWLWYLPALFMDCMLTYPLLAWSIRRSQKIPFNGRDDGNIVFLQLAIFVAWCYPAFYLDTSNNY
Ga0194117_1028788713300021424Freshwater LakeVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKFQAKTLPTIFSKLSWLWYLPALFVDCILTYPLLAWTIRRAAKIPFSSRDDVNILLLQVAIFIVWCFPCFYMDTSNDYGVRYLLPSTITLACIFACFYIFQLLIH
Ga0063132_10834313300021872MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLLPFVVGIFLFLIPRLYFGQQYEDFTRPNGKVEEDYWQFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQRDDGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSVLTLACVFFFFYTFQLLIHQEGGEKYAMWIKVIGPLGSCALNYWKD
Ga0063105_103646723300021887MarineMFFYISGMGATYFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKENMENDYWEFNKLILPGIMSRLSWLWYLPALFVDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDNYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNMWKN
Ga0063102_102018723300021941MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYWEFNRLIIPGIMSRLSWLWYLPALFLDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIIMLFYVV
Ga0063102_103003713300021941MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYWEFNKLIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIIMLFYVV
Ga0222713_1035053813300021962Estuarine WaterMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC
Ga0255753_130635013300022926Salt MarshMFFYISGMGSTFFNTEGKGFGIFVYDKVLRLMVPFVLAIFIFLIPRLYFGQPYEDFCRPDGKIENDYWEFQRKTLPTIFSKLSWLWYLPALFIDCIITYPLLAWSIRRARKIPFDAKDDGNIVFLQAAILIVWCYPAIYMDTSMNYGVRYLLPSI
Ga0247724_101672813300024239Deep Subsurface SedimentMFFYISGMGATFFNTEGKGFGIFVTDKILRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC
Ga0244775_1020861323300024346EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC
Ga0209198_104043223300025640Pelagic MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTIENNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0208544_1031292413300025887AqueousGMGATFFNTEGKGFGIFCFDKVLRLMVPFVLAIFIFLIPRLYYGQMYEDWTRPDKKNIENDYWTFQMNTLPNIFSKLSWLWYLPALFVDCILTYPLLAWSIRRAKKIPFNGRDDGNIVFLQLVILVLWCYPAFYLDTDDNYG
Ga0209631_1008716633300025890Pelagic MarineMFFYISGMGATFFNTEGKGFGNFVLNKVLRLLVPFVVAIFIFLMPRLYFGQPYEEFCRPDGKNIEEDYWQFNQKTLEYNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPVIYMDTGNNYGMRYLLPSVMTLAAIMFVFYVA
Ga0209631_1008737223300025890Pelagic MarineMFFYISGMGATFFNTEGKGFFLFTWGKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDGEHMESDYWTFNKLILPSIFSKLSWLWYLPALFMDCMLTYPLLAWSIRRSQKIPFNGRDDGNIVFLQLAIFVAWCYPAFYLDTSNNYGQRFLLPSILTLAIIIMLFYVL
Ga0209631_1023449913300025890Pelagic MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSV
Ga0209425_1021954823300025897Pelagic MarineMFFYISGMGSTFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLLPRLYYGQPYEEFCRPDGKHIENDYWEFQKQSLPNIFAKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFEARDDGNIVFLQVAILVVWCYPAIYMDTGNNYGVRYLLPSIATLAAVMFFFYTA
Ga0247607_109707813300026447SeawaterGIPMFFYISGMGATFFNTEGKGFGNFIGNKVLRLMVPFVVAIFIFLIPRLYFGEPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVMFVFYIA
Ga0247594_100689323300026448SeawaterMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLVPRLYFGQQYEDFTRPNGKVEEDYWQFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQRDDGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSTLTLACIFFFFYTFQLLIHQEGGEKYAMWIKIIGPLGSCALNYWKD
Ga0247594_103060313300026448SeawaterMFFYISGMGATFFNTEGKGFGNFIGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVMFVFYIA
Ga0208674_105306113300027190EstuarineLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVENDYWTFQMNTLPKIFSKLSWLWYLPALFIDCILTYPLLAWSIRRAKKIPFNARDDGNIVFLQLAILAIWCYPCFYLDTSYNYGTRYLLPSILTLAIFMFLFYVC
Ga0208174_105215313300027243EstuarineYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFFIAIFVFLIPRLYFGQSYEDFCKPDGKNVEEDYWTFQMKTLPTIGSKLSWLWYLPALFIDCMLTYPLLAWTVRRSRKIPFDQRDDGNIVFLQLAIFVVWCYPCFYMDTGNNYGVRYLLPSNLTLACIIFFFYTFQLLI
Ga0209279_1009806913300027771MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYLLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCIYMDTGNN
Ga0209830_1048001613300027791MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGV
Ga0209712_1071308113300027849MarineGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYWEFNKLIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGQRFLLPSILTLAIIIMLFYVV
Ga0256412_112653113300028137SeawaterMFFYISGMGATYFNTEGKGFFLFTWNKILRLIIPFIIAIFVFLIPRLYFGQPYEEWCRPDKENMENDYWEFNKQILPGIFSRLSWLWYLPALFIDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNMWKN
Ga0257132_110525613300028671MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYM
Ga0307403_1040743023300030671MarineGFFLFTWNKILRLFIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMLFYVV
Ga0307398_1032266623300030699MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFVDCMLTYPLLAWSIRRSQKIPFNGRDDGNIVVLQLGILVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMAFYVV
Ga0307398_1073816213300030699MarineTFFNTEGKGFGNFVGNKVLRLMVPFVVAIFIFLIPRLYFGQTYEEFCRPDGKNIEEDYWTFQTKTLEGNIFSKLSWLWYLPALFIDCIITYPLVAWSIRRSRKIPFDARDDGNIVFLQIAIFVVWLYPAVYMDTGNGYGMRYLLPSTLTLMAIMFVFYIAQLAVYTENGDKYAMIIKLVG
Ga0307399_1033392613300030702MarineFFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMLTYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMAFYVV
Ga0307400_1020927013300030709MarineFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYLLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCIYMDTGNNYGMRYLLPSVMTLAAVLFVFYIA
Ga0307400_1068330413300030709MarineMGATFYNTEGKGFFLFTWGKILRLLIPFVIAIFVFLIPRLYLGQPYEDWTRPDGEHIESDYWTYNRLILPSIFAKLSWLWYLPALFIDCILTYPLLAWSVRRSRKIPFNGRDDGNIVFLQLAILVAWCYPAFYLDVGENYG
Ga0073978_100658813300031036MarineLRLMIPFVIAIFIFLIPRLYFGQPYEEFCRPDGVMENDYWEFQRKTLPTVLSKLSWLWYLPALFIDCIITYPLLAWSVRRARKIPFNGRDDGNIIFLQLGIFVVWCYPAFYLDTSYNYGVRFLLPSIITLMIIFMLFYSF
Ga0308134_102537913300031579MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTIEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVMTLAAVLFVFYIA
Ga0307391_1009484413300031729MarineMGATFYNTEGKGFFLFTWGKILRLLIPFVIAIFIFLIPRLYLGQPYEDWTRPDGEHIENDYWTYNRLILPNIFAKLSWLWYLPALFIDCILTYPLLAWSVRRSRKIPFNGRDDGNIVFLQLAILVAWCYPAFYLDVGENYG
Ga0307394_1015293423300031735MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLFIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGILVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMLFYVV
Ga0307384_1005299713300031738MarineMFFYISGMGATFFNTEGKGFGIFVGDKILRLMVPFIAAIFIFLIPRLYFGQQYEDFTRPDGKIEEDYWQFMIKTLPTIFSKLSWLWYLPALFIDCIITYPLLAWSVRRSKKIPFDTKDDGNIIFLQIAIFVVWCYPCFYMDTSNNYGVRYLFPSILTLACVFFAFYTFQLAIYTENG
Ga0307384_1023226023300031738MarineMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYWEFNKLIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDNDDDYGQRFLLPSILTLAIIMMLFYVV
Ga0307384_1040777913300031738MarineMGATFFNTEGKGFFLFTWNKILRLMIPFAIAIFIFLIPRLYFGQPYEDWCRPDGEHIENDYWTFNRLILPSIFSKLSWLWYLPALFIDCILTYPLLAFSIRRSKKIPFNGRDDGNIIFLQLAIFVAWCYPAFYLDTGENFGQRFLLPSILTLAIIMMLYYVL
Ga0307384_1067260513300031738MarineFLFTWNKILRLLIPFVVAIFIFLIPRLYFGQPYEDWCRPDGEHIESDYWTFNKLILPSIFSKLSWLWYLPALFMDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLAIFVAWCYPAFYLDTSNNYGQRFLLPSILTLAIIIMLFYVL
Ga0307383_1013011823300031739MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDGEHIESDYWTFNKLILPSIFSKLSWLWYLPALFMDCMLTYPLLAWSVRRSQKIPFNGRDDGNIVFLQLAIFVAWCYPAFYLDTSNNYGQRFLLPSILTLAIIIMLFYVL
Ga0307383_1054001213300031739MarineFFYISGMGATFFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGTRFLLPSILTLAIIMMLFYVF
Ga0307395_1029967713300031742MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGILSRLSWLWYLPALFIDCMITYPLLAWSIRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSI
Ga0307382_1039820813300031743MarineEGKGFFLFTWGKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDGEHVETDYWTYNKLILPSIFSKLSWLWYLPALFMDCILTYPLLAWSVRRSRKIPFNGRDDGNIVFLQLAIFVAWCYPAFYLDTSDNYGQRFLLPSILTLAIVMMLFYVLQLAINTENGDKYAMWMKLLGPIGSICLNLWKD
Ga0314684_1009590123300032463SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVACSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314684_1024947713300032463SeawaterMVPFIVAIFIFLIPRLYFGQQYEDFCRPNGKDIEDDYWTFQTKTLQGNIFIKLSWLWYLPALFIDCILTYPLVAWSIRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCVYMDTGNGYGMRYLLPSVLTLAGIMFIFYIA
Ga0314670_1012894323300032470SeawaterGIPMFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314668_1012721023300032481SeawaterGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314675_1006003023300032491SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314688_1007983123300032517SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTIENNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314689_1014017913300032518SeawaterGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314676_1080512313300032519SeawaterGNKVLRLMVPFIVAIFIFLIPRLYFGQQYEDFCRPNGKDIEDDYWTFQTKTLQGNIFIKLSWLWYLPALFIDCILTYPLVAWSIRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCVYMDTGNGYGMRYLLPSVLTLAGIMFIFYIA
Ga0314667_1014716823300032520SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNEKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314682_1011735033300032540SeawaterMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNLWKN
Ga0314683_1067583913300032617SeawaterMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSVLTLACIFF
Ga0314673_1012908823300032650SeawaterVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314681_1060415613300032711SeawaterFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGIMSRLSWLWYLPALFIDCMITYPLLAWSVRRSQKIPFNGRDDGNIVFLQLGIFVAWCYPAFYLDTDDDYGQRFLLPSILTLSIIMMLFYVLQLSIHTENGAKYAMMIKILGPCGSIALNLWKN
Ga0314690_1014817013300032713SeawaterKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314703_1008754013300032723SeawaterFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314695_105949713300032724SeawaterGNFVGNKVLRLMVPFIVAIFIFLIPRLYFGQQYEDFCRPNGKDIEDDYWTFQTKTLQGNIFIKLSWLWYLPALFIDCILTYPLVAWSIRRSRKIPFDARDDGNIVFLQVAIFIVWLYPCVYMDTGNGYGMRYLLPSVLTLAGIMFIFYIA
Ga0314697_1024648213300032729SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLF
Ga0314699_1033508213300032730SeawaterGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSVLTLACIFFFFYTFQLLIHQEGGEKYAMWIKIIGPLGSCALNYWKD
Ga0314714_1006713123300032733SeawaterMFFYISGMGATFYNTEGKGFGSFEGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314707_1006334523300032743SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0314708_1013799723300032750SeawaterFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKLSWLWYLPALFIDCILTYPLLAWSVRRAKKIPFDQAADGNIVFLQIAIFVIWCYPCFYMDTSMNYGVRYLFPSVLTLSCIFFFFYTFQLLIHQEGGEKYAMWIKIIGPLGSCALNYWKD
Ga0314694_1009279523300032751SeawaterGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDYWLFNQKTLEHNVFTKLSWLWYLPALFIDCILTYPLVAWSLRRSRKIPFDARDDGNIVFLQVAIFVVWLYPCIYMDTGNNYGMRYLLPSVLTLAAVLFVFYIA
Ga0307390_1028270323300033572MarineFFLFTWGKILRLLIPFVIAIFIFLIPRLYLGQPYEDWTRPDGEHIENDYWTYNRLILPNIFAKLSWLWYLPALFIDCILTYPLLAWSVRRSRKIPFNGRDDGNIVFLQLAILVAWCYPAFYLDVGENYG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.