 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F094374 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRDGKNEG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.23 % |
| % of genes from short scaffolds (< 2000 bps) | 88.68 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.887 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (9.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.340 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01926 | MMR_HSR1 | 22.64 |
| PF05362 | Lon_C | 4.72 |
| PF10431 | ClpB_D2-small | 0.94 |
| PF05013 | FGase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 4.72 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 4.72 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 4.72 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 4.72 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.94 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.89 % |
| All Organisms | root | All Organisms | 48.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.77% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 2.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_111930851 | 3300000953 | Soil | MSQRTRSRASSANSDGNGEDGGTVATAEAPERDGRDSGREKNEG |
| JGI24736J21556_10458591 | 3300001904 | Corn Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEPERESRDGRD |
| soilH1_100210776 | 3300003321 | Sugarcane Root And Bulk Soil | MSQRTRSRASSANNDNDGDNGGATVATAEAPERETRESRDGKNEGFHNLAD |
| Ga0062593_1018533782 | 3300004114 | Soil | MSQRTRSRASSANNDANGDDGGATVATAEAPERESRESRDGKNEGF |
| Ga0062593_1022771511 | 3300004114 | Soil | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRESRDGKNE |
| Ga0062589_1018054281 | 3300004156 | Soil | MSQRTRSRASSANNANDGDDGGATVATAEAPERESRESRDGKNEGFH |
| Ga0062592_1017806262 | 3300004480 | Soil | MSQRTRSRASSANNDANGDDGGATVATAEAPERESRESRDGKNEGFH |
| Ga0065704_103666012 | 3300005289 | Switchgrass Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESREPRDGKNEGFHNLAD |
| Ga0065715_104620011 | 3300005293 | Miscanthus Rhizosphere | MSQRTRSRASSANNADNGDDGGSTVATAEAPERESRESRDGKNEGF |
| Ga0065707_110849181 | 3300005295 | Switchgrass Rhizosphere | MSQRTRSRASSANNDANGDDGGATVATAEAPERESRESRDGKNEG |
| Ga0070670_1021558612 | 3300005331 | Switchgrass Rhizosphere | MSQRTRSRASSANNDTDGDNGGATVATAEAPERESRESRD |
| Ga0066388_1041725311 | 3300005332 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDNGGTVATAEAPEREANEGRSGKNEG |
| Ga0070680_1018197201 | 3300005336 | Corn Rhizosphere | MSQRTRSRASSANNDANGDDGGSTVATAEAPERESRESRDGK |
| Ga0070694_1011440881 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRTRSRASSANNEANGEDSGGTVATAEAPERETRDGRE |
| Ga0070706_1005247301 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRTRSRASGGVNNDANGENGSTVATAEVPERDNRDGRESRDE |
| Ga0070698_1000406161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRTRSRASSANNDANGDDGGATVATAEAPEREPRESRD |
| Ga0070693_1011425602 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRESRDGKNEGFHN |
| Ga0070665_1008330012 | 3300005548 | Switchgrass Rhizosphere | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRE |
| Ga0068855_1008387351 | 3300005563 | Corn Rhizosphere | MSQRTRSRASSANTDANGEDGGTTVATAEAPERESRETRDGKNEGFHN |
| Ga0068855_1019916572 | 3300005563 | Corn Rhizosphere | MSQRTRSRASSANNDADGDNGGTTVATAEAPERESR |
| Ga0068857_1012300092 | 3300005577 | Corn Rhizosphere | MSQRTRRASSANNNDNGEDGGTTVATAEAPERESREARD |
| Ga0070702_1007451551 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRSRSRASSANNEANGEDNGGTVATAEAPERESRGERDGKNEGFHNL |
| Ga0068852_1005694001 | 3300005616 | Corn Rhizosphere | MSQRTRSRASSANNDADGDNGGTVATAEAPERETRESRDGKNEG |
| Ga0068852_1019551052 | 3300005616 | Corn Rhizosphere | MSQRTRSRASSANNDADGDNGGATVATAEAPERESRETRDGKNEGFH |
| Ga0068864_1001502404 | 3300005618 | Switchgrass Rhizosphere | MSQRTRSRASSANNEANGEDNSGTVATAEAPEREEKEGRSGKNEGFH |
| Ga0068861_1001320394 | 3300005719 | Switchgrass Rhizosphere | MSQRTRSRASSANSDGNGEDGGTVATAEAPEREGRDGREKNEGFHNL |
| Ga0068870_104502461 | 3300005840 | Miscanthus Rhizosphere | MSQRTRSRASSANNADNGDDGGATVATAEAPERESREGRDLKNEGFHNLAD |
| Ga0082029_10870302 | 3300006169 | Termite Nest | MSQRTRSRASSANNDANGEDGGATVATAEAPEREAR |
| Ga0070716_1016159561 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQRTRRASSASTDNNGDDGGASVATAEAPEREPRESRDGGK |
| Ga0068871_1012148872 | 3300006358 | Miscanthus Rhizosphere | MSQRTRSRASSANNDDNDDGTSVATADAPERDGSERRGK |
| Ga0079222_113681573 | 3300006755 | Agricultural Soil | MSQRTRSRASSANNADNGDDGGSTVATAEAPERESRESRDG |
| Ga0075428_1002866444 | 3300006844 | Populus Rhizosphere | MSQRTRSRASSANSDANGEDGGTVATAEAPEREREG |
| Ga0075428_1009340862 | 3300006844 | Populus Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPEREARETRDGKNEGF |
| Ga0079219_109856571 | 3300006954 | Agricultural Soil | MSQRTRSRASSANNEANGEDSGGNVATAEAPERETRDGREGKNEGFH |
| Ga0075419_106277842 | 3300006969 | Populus Rhizosphere | MSQRTRSRASSANSDSNGEDGGTVATAEAPEREGREGRDGREK |
| Ga0075419_108438062 | 3300006969 | Populus Rhizosphere | MSQRTRSRASSANNEANGEDAGGTVATAEAPEREARESRDGKNEGFHNLAD |
| Ga0105243_123784772 | 3300009148 | Miscanthus Rhizosphere | MSQRTRSRASSANNDDNDDGASVATADAPERDGGERRGKEEGFLN |
| Ga0105243_124089271 | 3300009148 | Miscanthus Rhizosphere | MSQRTRSRASSANNDANGEDGGATIATAEAPERESRDGRDGGKNEG |
| Ga0075423_108342692 | 3300009162 | Populus Rhizosphere | MSQRTRSRASSANNDANGDDGGATVATAEAPERESRDSRDGKNEGFH |
| Ga0105242_102517913 | 3300009176 | Miscanthus Rhizosphere | MSQRTRSRASSANSDGNGEDGGTVATAEAPEREGRDGREKNEGFHNLAD |
| Ga0105248_127334362 | 3300009177 | Switchgrass Rhizosphere | MSQRTRSRASSANNEANNEDNGGTVATAEAPEREPRERGEGK |
| Ga0126309_101262413 | 3300010039 | Serpentine Soil | MSQRTRSRASSANNDANGEDGGATVATAEAPEREPREPRDA |
| Ga0126382_109401832 | 3300010047 | Tropical Forest Soil | MSQRTRSRASSANNDSNGEDNGATVATAEAPEREPRE |
| Ga0126382_117063321 | 3300010047 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRDSRDGGKNEGFHN |
| Ga0126382_124058111 | 3300010047 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDGGTVATAEAPEREPREGREGKNEGFH |
| Ga0126376_116965382 | 3300010359 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRDGKN |
| Ga0126372_106296332 | 3300010360 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDNGTTVATAEAPEREGREGREAKTEGFHNLAD |
| Ga0105239_124863471 | 3300010375 | Corn Rhizosphere | MSQRTRSRASSANNDADGDNGGATVATAEAPERETRDG |
| Ga0134124_120931802 | 3300010397 | Terrestrial Soil | MSQRTRSRASSANNDADGDNGGATVATAEAPERETRESRDGKNEG |
| Ga0134122_117858752 | 3300010400 | Terrestrial Soil | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRESRDGKNEGFH |
| Ga0134121_113233642 | 3300010401 | Terrestrial Soil | MSQRTRSRASSANNEASTEDSGGNVATAEAPERETRDGREGKNE |
| Ga0134123_114030672 | 3300010403 | Terrestrial Soil | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRESRDGKNEGFHNL |
| Ga0105246_102378973 | 3300011119 | Miscanthus Rhizosphere | MSQRTRSRASSANNEANGEDNGGTVATAEAPDREPGEGRSG |
| Ga0127502_105328741 | 3300011333 | Soil | MSQRTRSRASSANNDANGDDGGTTVATAEAPEREP |
| Ga0120182_10014492 | 3300011993 | Terrestrial | MSQRTRSRASSANNADNGDDGGATVATAEAPERESRESRDGKN |
| Ga0120187_10190211 | 3300012015 | Terrestrial | MSQRTRSRASSANNDANGEDGGATVATAEAPEREARETRDGKNEGFHNLA |
| Ga0137399_107729512 | 3300012203 | Vadose Zone Soil | MSQRTPRARASGASNDSNGDDNGASTVATAEAPPEK |
| Ga0137386_108518542 | 3300012351 | Vadose Zone Soil | MSQRTRSRASSANNDANGEDGGTTVATAEAPEREPRDGREAKNEGFHNL |
| Ga0157314_10315602 | 3300012500 | Arabidopsis Rhizosphere | MSQRTRSRASSANNEGNGEDGGTVATAEAPERESREGRDAK |
| Ga0157316_10592201 | 3300012510 | Arabidopsis Rhizosphere | MSQRTRSRASSANSDGNGEDGGTVATAEAPEREGRDGREKNEG |
| Ga0126375_115703031 | 3300012948 | Tropical Forest Soil | MSQRTRSRASSANNDANGEDGGTVATAEAPEREPRESREGKNEGFHNL |
| Ga0164299_109751962 | 3300012958 | Soil | MSQRTRRASSANTDNNGDDGGSSVATAEAPERETRESRD |
| Ga0164302_104425882 | 3300012961 | Soil | MSQRTRSRASSANNDDNDDGASVATADAPERDGGE |
| Ga0157373_115060561 | 3300013100 | Corn Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRD |
| Ga0163162_124392212 | 3300013306 | Switchgrass Rhizosphere | MSQRTRSRASSANNDANGDDGGASVATAEAPERET |
| Ga0157375_125871032 | 3300013308 | Miscanthus Rhizosphere | MSQRTRSRASSANNADNGDDGGSTVATAEAPEREPRESRDGKNE |
| Ga0120183_10289391 | 3300013754 | Terrestrial | MSQRTRSRASSANNDANGDDGGATVATAEAPEREAR |
| Ga0157377_113437211 | 3300014745 | Miscanthus Rhizosphere | MSQRTRSRASSANNDADGDNGGTVATAEAPERETREPR |
| Ga0132256_1024832621 | 3300015372 | Arabidopsis Rhizosphere | MSQRTRSRASNANNEANGEDGGNIATAEVAERESRDGRES |
| Ga0132255_1000684285 | 3300015374 | Arabidopsis Rhizosphere | MSQRTRSRASSANNDANAEDGGTVATAEVPERETREGREGKNEGFH |
| Ga0184625_100069305 | 3300018081 | Groundwater Sediment | MSQRTRSRASSANNEANSEDNGGTVATADAPEREAGEGRTGKNEG |
| Ga0190268_121491351 | 3300018466 | Soil | MAQRTRSRASSANSDDANGDSVVATAEAPEREGREGRDRGEEGF |
| Ga0190264_119446171 | 3300019377 | Soil | MAQRTRSRASGANTDDSDGDNGGATVATAEVPEADGREGRQGGE |
| Ga0193713_11662691 | 3300019882 | Soil | MSQRTRSRASASANNDANGEDGGTTIATAEAPEREPRDGREAK |
| Ga0193736_10569992 | 3300021412 | Soil | MAQRTRSRASGANTDDSDGDNGGATVATAEAPETDG |
| Ga0207682_100828772 | 3300025893 | Miscanthus Rhizosphere | MSQRTRSRASSANTDSDGDNGGATVATAEAPEREPRESRDRDRD |
| Ga0207647_106302471 | 3300025904 | Corn Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESR |
| Ga0207654_100377301 | 3300025911 | Corn Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRDGKNEGFHNLA |
| Ga0207650_118994511 | 3300025925 | Switchgrass Rhizosphere | MSQRTRSRASSANNDANGDDGGATVATAEAPERESRESRDGKNEGFHNL |
| Ga0207709_103433961 | 3300025935 | Miscanthus Rhizosphere | MSQRTRSRASSANNDDNDDGTSVATADAPERDGGERRGKEE |
| Ga0207670_106719431 | 3300025936 | Switchgrass Rhizosphere | MSQRTRSRASSANSDGNGEDGGTVATAEAPEREGRDGREKNEGFHNLADL |
| Ga0207669_118443571 | 3300025937 | Miscanthus Rhizosphere | MSQRTRSRASSANNDADGDNGGATVATAEAPERETR |
| Ga0207704_106823312 | 3300025938 | Miscanthus Rhizosphere | MSQRTRSRASSANNDANAEDGGIVATAEVPERETREGREGKNE |
| Ga0207651_103658701 | 3300025960 | Switchgrass Rhizosphere | MSQRTRSRASSANNDDNDDGASVATADAPERDGGERRGKEE |
| Ga0207668_116733002 | 3300025972 | Switchgrass Rhizosphere | MSQRTRSRASSANNEANGEDNGGTVATAEAPDREPGEGRPGKNE |
| Ga0207640_108385382 | 3300025981 | Corn Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPEREARETRDGKNEGFHNLAD |
| Ga0207703_121673551 | 3300026035 | Switchgrass Rhizosphere | MSQRTRSRASSANNANDGDDGGATVATAEAPERESRESRD |
| Ga0207674_108970421 | 3300026116 | Corn Rhizosphere | MSQRTRRASSANNNDNGEDGGTTVATAEAPERESREAR |
| Ga0207674_110604911 | 3300026116 | Corn Rhizosphere | MSQRTRSRASSANNEANGEDNGGTVATAEAPEREPGEGRSGKNEGG |
| Ga0209153_11054273 | 3300026312 | Soil | MSQRTRSRASSANNDANGDDGGASVATAEAPERES |
| Ga0209215_10021801 | 3300027266 | Forest Soil | MSQRTRSRAQSANNDANGDDGGATVATAEAPERETRESRDGGKNE |
| Ga0209215_10302671 | 3300027266 | Forest Soil | MSQRTRSRASSANNDANGEDGGATVATAEAPERESKDGRDGGKNEGFHNL |
| Ga0209177_102580691 | 3300027775 | Agricultural Soil | MSQRTRRASSASTDNNGDDGGASVATAEAPEREPRESRDGGKNEGFH |
| Ga0209814_103642151 | 3300027873 | Populus Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRDGKNEGFHN |
| Ga0209974_104115442 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MSQRTRSRASSANNEANGDDGGATVATAEAPEREPRESRDGKKE |
| Ga0209481_101244303 | 3300027880 | Populus Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPEREPREARDGKNEGFHNLAD |
| Ga0209481_105152732 | 3300027880 | Populus Rhizosphere | MSQRTRSRASSANNDANGEDGGNIATAEAPERETRDG |
| Ga0268265_112429742 | 3300028380 | Switchgrass Rhizosphere | MSQRTRRASSSANNDANGEDGGATVATAEAPEREPRE |
| Ga0268264_106079261 | 3300028381 | Switchgrass Rhizosphere | MSQRTRSRASSANNDADGDNGGTVATAEAPERETRESRNGK |
| Ga0308187_101810203 | 3300031114 | Soil | MSQRTRSRATSANNDANGEDGGTTVATDDAPEREPREGREPKGEGGFH |
| Ga0307413_111828782 | 3300031824 | Rhizosphere | MSQRTRSRASSANNADNGDDGGATVATAEAPERESREGR |
| Ga0307414_113690892 | 3300032004 | Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERETRESRDGKNEGFHNLAD |
| Ga0307411_101318741 | 3300032005 | Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESRESRDGKNEG |
| Ga0307415_1021794982 | 3300032126 | Rhizosphere | MSQRTRSRASSANNDANGEDGGATVATAEAPERESREARDSKNEG |
| Ga0307471_1017606201 | 3300032180 | Hardwood Forest Soil | MSQRTRSRASSANNEANGEDGGNVATAEVPERETRDGREGKNEGFHNL |
| Ga0314792_171031_1_126 | 3300034667 | Soil | MSQRTRSRASSANSDANGEDGGTVATAEAPEREREGRDGRER |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |