NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094353

Metagenome Family F094353

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094353
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 46 residues
Representative Sequence IRGEKFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF
Number of Associated Samples 87
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.89 %
% of genes near scaffold ends (potentially truncated) 94.34 %
% of genes from short scaffolds (< 2000 bps) 84.91 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.226 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(18.868 % of family members)
Environment Ontology (ENVO) Unclassified
(36.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.755 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.97%    β-sheet: 0.00%    Coil/Unstructured: 77.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00072Response_reg 4.72
PF00069Pkinase 1.89
PF02518HATPase_c 1.89
PF00226DnaJ 0.94
PF00924MS_channel 0.94
PF14373Imm_superinfect 0.94
PF09414RNA_ligase 0.94
PF03030H_PPase 0.94
PF01797Y1_Tnp 0.94
PF07589PEP-CTERM 0.94
PF00581Rhodanese 0.94
PF13426PAS_9 0.94
PF00665rve 0.94
PF04392ABC_sub_bind 0.94
PF00486Trans_reg_C 0.94
PF13531SBP_bac_11 0.94
PF09084NMT1 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.55
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.94
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.94
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.94
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.94
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.94
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.94
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.94
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.94
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.94
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.94
COG4584TransposaseMobilome: prophages, transposons [X] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.23 %
UnclassifiedrootN/A3.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100223972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300004266|Ga0055457_10134939All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300004463|Ga0063356_100393932All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300004463|Ga0063356_104068480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300004643|Ga0062591_101511316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300005293|Ga0065715_10189753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1422Open in IMG/M
3300005295|Ga0065707_10019283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1274Open in IMG/M
3300005327|Ga0070658_10869325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300005332|Ga0066388_103774234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300005336|Ga0070680_100698836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium872Open in IMG/M
3300005339|Ga0070660_101662832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300005353|Ga0070669_100506941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1001Open in IMG/M
3300005365|Ga0070688_100465117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium948Open in IMG/M
3300005366|Ga0070659_101293772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300005455|Ga0070663_101132311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300005457|Ga0070662_100444411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1075Open in IMG/M
3300005459|Ga0068867_101517213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300005526|Ga0073909_10064877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1363Open in IMG/M
3300005546|Ga0070696_100753395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium798Open in IMG/M
3300005577|Ga0068857_100721527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium948Open in IMG/M
3300005577|Ga0068857_102489035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300005719|Ga0068861_100105746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_122247Open in IMG/M
3300005764|Ga0066903_107475444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300005842|Ga0068858_101211622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300006046|Ga0066652_101009694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300006169|Ga0082029_1803047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300006797|Ga0066659_10847699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300006806|Ga0079220_10491787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300006844|Ga0075428_100096133All Organisms → cellular organisms → Bacteria → Proteobacteria3229Open in IMG/M
3300006844|Ga0075428_101295381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300006847|Ga0075431_100006571All Organisms → cellular organisms → Bacteria11553Open in IMG/M
3300006853|Ga0075420_101808711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300006853|Ga0075420_101846842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300006854|Ga0075425_100285083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1901Open in IMG/M
3300006880|Ga0075429_100076681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2911Open in IMG/M
3300006880|Ga0075429_100703904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium885Open in IMG/M
3300006880|Ga0075429_101895358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300006903|Ga0075426_10385569Not Available1033Open in IMG/M
3300006904|Ga0075424_100000553All Organisms → cellular organisms → Bacteria29573Open in IMG/M
3300006904|Ga0075424_100092839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3176Open in IMG/M
3300006914|Ga0075436_100648318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300006954|Ga0079219_11253679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300006969|Ga0075419_10767255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300009100|Ga0075418_10155472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2434Open in IMG/M
3300009100|Ga0075418_12339104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300009147|Ga0114129_12181105All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009162|Ga0075423_11852699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300010047|Ga0126382_11729371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300010362|Ga0126377_12608581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300010371|Ga0134125_10304058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1771Open in IMG/M
3300010373|Ga0134128_10475265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1394Open in IMG/M
3300012201|Ga0137365_10720695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300012209|Ga0137379_10915042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300012362|Ga0137361_10317905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1426Open in IMG/M
3300012492|Ga0157335_1017644All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012532|Ga0137373_10900173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300012582|Ga0137358_10542194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300012884|Ga0157300_1067066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300012896|Ga0157303_10138824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300012901|Ga0157288_10156343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300012911|Ga0157301_10352659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300012924|Ga0137413_10339285All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300012929|Ga0137404_10989508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300012930|Ga0137407_10297541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1475Open in IMG/M
3300013297|Ga0157378_10215159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1824Open in IMG/M
3300014315|Ga0075350_1216582All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300015242|Ga0137412_10659620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300015264|Ga0137403_10108721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2776Open in IMG/M
3300015371|Ga0132258_10618706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2720Open in IMG/M
3300015371|Ga0132258_10672660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2605Open in IMG/M
3300015372|Ga0132256_100141166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2404Open in IMG/M
3300015372|Ga0132256_100336723All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300015372|Ga0132256_101270336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium849Open in IMG/M
3300015372|Ga0132256_102728463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300015372|Ga0132256_103350422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300015373|Ga0132257_100147876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2750Open in IMG/M
3300015373|Ga0132257_100687094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1271Open in IMG/M
3300015373|Ga0132257_103727957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300015374|Ga0132255_100178933All Organisms → cellular organisms → Bacteria2985Open in IMG/M
3300015374|Ga0132255_100836615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1373Open in IMG/M
3300015374|Ga0132255_101570335All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300017792|Ga0163161_11171077All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300018028|Ga0184608_10232891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium810Open in IMG/M
3300018076|Ga0184609_10158857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1043Open in IMG/M
3300018422|Ga0190265_13181285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300018469|Ga0190270_11798542Not Available668Open in IMG/M
3300020006|Ga0193735_1105156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300020061|Ga0193716_1010897All Organisms → cellular organisms → Bacteria4672Open in IMG/M
3300021073|Ga0210378_10036679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1950Open in IMG/M
3300025909|Ga0207705_10691783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300025923|Ga0207681_11218394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300025930|Ga0207701_10087545Not Available2807Open in IMG/M
3300025930|Ga0207701_11004861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300025931|Ga0207644_10712146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300025931|Ga0207644_11584287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300025932|Ga0207690_10276682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1306Open in IMG/M
3300025960|Ga0207651_11932307Not Available531Open in IMG/M
3300025986|Ga0207658_10422095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1176Open in IMG/M
3300027873|Ga0209814_10284615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300027907|Ga0207428_10677903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300031446|Ga0170820_16746176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300031716|Ga0310813_11564589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300031740|Ga0307468_100851695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12784Open in IMG/M
3300032075|Ga0310890_11711483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300033475|Ga0310811_10120389All Organisms → cellular organisms → Bacteria → Proteobacteria3363Open in IMG/M
3300033487|Ga0316630_11242010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere18.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere7.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere4.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004266Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10022397213300000559SoilIVEGIRGEEFTAGFYDMTKWEEYRRENEKNVCDSCMFADPKYLERYGSCF*
Ga0055457_1013493913300004266Natural And Restored WetlandsGQEFTAGFYDMTKWEEFRRENEQHLCASCMFADPKYIERYGSCF*
Ga0063356_10039393253300004463Arabidopsis Thaliana RhizosphereFIGGFYDMAKWEEYRRDNEQYVCDSCMFADPKYVERYGSCF*
Ga0063356_10406848013300004463Arabidopsis Thaliana RhizosphereEFTAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF*
Ga0062591_10151131623300004643SoilIRGEEFTAGFYDMTKWEEYRRDNERHVCESCMFADPKYVERYGSCF*
Ga0065715_1018975313300005293Miscanthus RhizosphereFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0065707_1001928333300005295Switchgrass RhizosphereCDRCQQIVEGIRGEEFSAGFYDMSKWEEYRRHNERYVCESCMFADPKYIERYGSCF*
Ga0070658_1086932513300005327Corn RhizosphereVIEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0066388_10377423413300005332Tropical Forest SoilKVVEGIRGEKFTAGFYDMTKWEEYRRDNEQYVCEPCMFADPKYLERYGSRF*
Ga0070680_10069883613300005336Corn RhizosphereRGEEFSAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF*
Ga0070660_10166283213300005339Corn RhizosphereFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070669_10050694123300005353Switchgrass RhizosphereTCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070688_10046511723300005365Switchgrass RhizosphereMCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGSCF*
Ga0070659_10129377223300005366Corn RhizosphereHLVEGIRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0070663_10113231113300005455Corn RhizosphereIRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0070662_10044441123300005457Corn RhizosphereIRGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF*
Ga0068867_10151721313300005459Miscanthus RhizosphereIEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0073909_1006487733300005526Surface SoilYDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0070696_10075339513300005546Corn, Switchgrass And Miscanthus RhizosphereKQVVEGIRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0068857_10072152713300005577Corn RhizosphereQIVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCELCMFADPKYIERYGSCF*
Ga0068857_10248903513300005577Corn RhizosphereRCKQVIEGIRGEEFCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF*
Ga0068861_10010574613300005719Switchgrass RhizosphereEGIRGEKFTSGFYDVTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0066903_10747544423300005764Tropical Forest SoilFYDMTKWEEYRRDNERYVCEPCMFADPKYLERYGSCF*
Ga0068858_10121162223300005842Switchgrass RhizosphereAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERYGSCF*
Ga0066652_10100969433300006046SoilMTKWEEYRRENEQYVCDSCMFADPRYVERYGSCF*
Ga0082029_180304723300006169Termite NestVSEQFIAGFYDMTKWEEYRRDNEQHVCSSCMFNDIKYLERYGSCF*
Ga0066659_1084769923300006797SoilICDRCKKIGEGIRGEGFTAGFYDMEKWEEYRLDENDRQVCGSFMFADPKYVERYGSCF*
Ga0079220_1049178713300006806Agricultural SoilMVEGLRGEQFTAGFYDMEKWEEYRRENERYVCEHCMFADPKYVDRYGSCF*
Ga0075428_10009613353300006844Populus RhizosphereEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075428_10129538123300006844Populus RhizosphereEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0075431_100006571123300006847Populus RhizosphereMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0075420_10180871133300006853Populus RhizosphereFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075420_10184684223300006853Populus RhizosphereFYDMTKWEEYRRENEQHLCASCMFADPKYVERYGSCF*
Ga0075425_10028508313300006854Populus RhizosphereAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0075429_10007668113300006880Populus RhizosphereDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075429_10070390423300006880Populus RhizosphereFTGGFFEMTKWQECRRGDEQYVCDPCMFADPKYLERYGSSF*
Ga0075429_10189535823300006880Populus RhizosphereMTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0075426_1038556923300006903Populus RhizosphereVTCDRCQQIVEGIRGEEFSAGFYDMIKWEEYRRDNERYVCESCMFADP
Ga0075424_10000055383300006904Populus RhizosphereMTKWEEYRRENERYVCESCMFADPKYIERFGSSF*
Ga0075424_10009283943300006904Populus RhizosphereMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0075436_10064831823300006914Populus RhizosphereFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF*
Ga0079219_1125367923300006954Agricultural SoilRGEDFSAGFYDMSKWEEYRRENERYVCESCMFADPKYIERFGSCF*
Ga0075419_1076725523300006969Populus RhizosphereFEMTKWQECRRGDEQYVCDPCMFADPKYLERYGSSF*
Ga0075418_1015547213300009100Populus RhizosphereGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0075418_1233910413300009100Populus RhizosphereAEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYDSCF*
Ga0114129_1218110523300009147Populus RhizosphereGFYDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0075423_1185269913300009162Populus RhizosphereEGIRGEEFTAGFYNMTKWEEYRRENEQNVCDSCMFADLKYVERYGSCF*
Ga0126382_1172937113300010047Tropical Forest SoilDMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0126377_1260858113300010362Tropical Forest SoilVVEGIRGKDYIGGFFEMTKWPQYRRENEERVCDSCMFADPQYVERYGSFF*
Ga0134125_1030405833300010371Terrestrial SoilDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGCCF*
Ga0134128_1047526513300010373Terrestrial SoilMTKWKEYRRDNERYVCDACMFADPKYAERYGSCF*
Ga0137365_1072069513300012201Vadose Zone SoilFYDMTKWEEYRHENEQYVCESCMFADPKYVERYGSCF*
Ga0137379_1091504213300012209Vadose Zone SoilDEFIAGFYDMTKWEEYRHENEQYVCDSCIFADPKYVERYGSCF*
Ga0137361_1031790513300012362Vadose Zone SoilDMAKWEEYRRENEQYECDSCMFADPRYVERYGSCF*
Ga0157335_101764423300012492Arabidopsis RhizosphereMTKWEEYRRDNEQYVCDSCMFADPKYVERYGSCF*
Ga0137373_1090017323300012532Vadose Zone SoilIVEGIRGEEFIAGFYDMTKWEEYRRENEQYVCHSCMFADPKYIERYGSCF*
Ga0137358_1054219423300012582Vadose Zone SoilFTSGFYDMTKWEEYRRENEQYVCDACMFADPKYVECYGSCF*
Ga0157300_106706613300012884SoilIRGEEFSAGFYDMNKWEEYRRDNERYVCESCMFADPKYIERFGSCF*
Ga0157303_1013882433300012896SoilRGEEFTAGFYDMTKWEEYRRENEQHLCVSCMFADAKYLERYGSCF*
Ga0157288_1015634323300012901SoilDRCKQIVEGIRGEEFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0157301_1035265913300012911SoilQVVEGIRGEEFCAGFYDMTKWEEYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0137413_1033928523300012924Vadose Zone SoilFYNMTKWKEYRREDEQYVCESCMFADLKYVERYGSCF*
Ga0137404_1098950833300012929Vadose Zone SoilFYDMTKWEEYRRENEQYVCDSCMFADPKYVERYGSCF*
Ga0137407_1029754113300012930Vadose Zone SoilICDRCKQIVEAIRGEKFTAGIYGMTKWEEYRRENERYVCESCMFADPKYLERYGSCF*
Ga0157378_1021515913300013297Miscanthus RhizosphereRGEQFTSGFYDITKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0075350_121658223300014315Natural And Restored WetlandsICDRCKQTIEGMRGREFIAGFYDMTKWEEYRHENEDHLCASCMFADPNYLERYGSCF*
Ga0137412_1065962023300015242Vadose Zone SoilVPRKEKGEQFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF*
Ga0137403_1010872143300015264Vadose Zone SoilDMTKWEEYRHENEQYVCDSCMFADPKYVERYGSCF*
Ga0132258_1061870653300015371Arabidopsis RhizosphereMCDRCKQLVDGIRREQFTAGFYDMAKWEEYRRDNERYVCESCMFADPKYVERYGSCF*
Ga0132258_1067266013300015371Arabidopsis RhizosphereAEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132256_10014116643300015372Arabidopsis RhizosphereQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132256_10033672313300015372Arabidopsis RhizosphereGFYDMTKWEEYRREKEQYVCESAMFADPKYVERYGSCF*
Ga0132256_10127033633300015372Arabidopsis RhizosphereCDRCKQIVEGIRGEEFSAGFYDMTKWEEYRRDNERYVCEACMFADPKYLERYGSCF*
Ga0132256_10272846313300015372Arabidopsis RhizosphereIRGEKFTSGFYDMTKWEEYRRENEQYVCESCMFADPKYVERYGSCF*
Ga0132256_10335042223300015372Arabidopsis RhizosphereEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYVERYGSCF*
Ga0132257_10014787613300015373Arabidopsis RhizosphereRCQQIAEGIRGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132257_10068709423300015373Arabidopsis RhizosphereDRCQQIVEGIRGEKFTTGFYDMATWEVYRRENEQYVCVSCMFADLKYVERYGSCF*
Ga0132257_10372795713300015373Arabidopsis RhizosphereGIRGEQFTSGFYDMTKWEEYRCEKEQYVCESCMFADPKYVERYGSCF*
Ga0132255_10017893353300015374Arabidopsis RhizosphereGEQFTSGFYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF*
Ga0132255_10083661513300015374Arabidopsis RhizosphereCDRCKQIVEGLRGEEFTAGFYDMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF*
Ga0132255_10157033523300015374Arabidopsis RhizosphereDRCKQIAEGIRGEQFTSGFYDMTKWEEYRCEKEQYVCESCMFADPKYVERYGSCF*
Ga0163161_1117107713300017792Switchgrass RhizosphereMCDRCKHLVEGIRGEEFSAGFYDMSKWEEYRRDNERYVCESCMFADPKYIERFGSCF
Ga0184608_1023289113300018028Groundwater SedimentFYNMTKWEEYRRENEQYVCASCMFADPKYVERYGSCF
Ga0184609_1015885733300018076Groundwater SedimentGFYDMTKWEEYRRESEQYVCDSCMFADPKYLERYGSCF
Ga0190265_1318128523300018422SoilYDMTKWEEYQRENEQYVCNSCMFADPKYVERYGSCF
Ga0190270_1179854223300018469SoilDRCKQIVEGIRGEEFTTGFYDMTTWEEYRRENEHYVCVSCMFADPKYVERYGSCF
Ga0193735_110515623300020006SoilEFTGGFYDMTRWEEYRRENEQHLCNSCMFADPKYVERYGSCF
Ga0193716_101089783300020061SoilVLFVQIVEGIRGEEFIAGFYEMTKWNEYQRENEQYVCNSCMFADPKYVERYGSCF
Ga0210378_1003667943300021073Groundwater SedimentIAGFYDMTKWEEYRRESEQYVCDPCMFADPKYLERYGSCF
Ga0207705_1069178323300025909Corn RhizosphereVIEGIRGQAFTAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF
Ga0207681_1121839423300025923Switchgrass RhizosphereEMFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF
Ga0207701_1008754513300025930Corn, Switchgrass And Miscanthus RhizosphereVICDRCKQIVEGIRGEQFTSGFYDMTKWEEYRREKEQYVCESCMFADPKYVERYGSCF
Ga0207701_1100486113300025930Corn, Switchgrass And Miscanthus RhizosphereFTTGFYNMATWEVYRRENEQYVCVSCMFADPKYVERYGSCF
Ga0207644_1071214613300025931Switchgrass RhizosphereDRCKQVVEGIRGDEFTAGFYDMTKWEDYRHDNERYVCESCMFADPKYLERYGSCF
Ga0207644_1158428723300025931Switchgrass RhizosphereRGEEFSAGFYDMIKWEEYRRDNERYVCESCMFADPRYIERYGSCF
Ga0207690_1027668213300025932Corn RhizosphereGEEFSAGFYDMSKWEEYRRDNECYVCESCMFADPKYIERFGSCF
Ga0207651_1193230713300025960Switchgrass RhizosphereEFTTGFYDMTTWEEYRRENEQIVCVSCMFADPKYVERYGSCF
Ga0207658_1042209533300025986Switchgrass RhizosphereAGFYDMSKWEEYRRDNENYVCEPCMFADPKYVERYGSSF
Ga0209814_1028461533300027873Populus RhizosphereYDMTKWEEYRRENEQHVCHSCMFADPKYLERYGSCF
Ga0207428_1067790323300027907Populus RhizosphereVEGIRGEDFSAGFYDMSKWEEYRRENERYVCESCMFADPKYIERFGSCF
Ga0170820_1674617623300031446Forest SoilFYDMTKWEEYRRENEQYVCDSCMFADPKYLERYGSCF
Ga0310813_1156458923300031716SoilRCKQIVEGIRGEEFSAGFYDMTKWEDYRRDNERYVCESCMFADPKYVERYGSCF
Ga0307468_10085169513300031740Hardwood Forest SoilIVEGIRGEQFTSGFYDMTKWEEYRREKEQYVCESCMFGDPKYVERYGSCF
Ga0310890_1171148333300032075SoilVICDRCKQTVEGIRGQEITAGFYDMTKWEEFRRENEQNLCAWCMFADPKYIDRYGSCF
Ga0310811_1012038913300033475SoilCAGFYDMTKWEEYRLDNERYVCESCMFADPKYVERYGSCF
Ga0316630_1124201013300033487SoilKQTINGIRGQGFIAGFYDMTKWEEYRRENEEHLCVSCMFADPKYLERYGSCF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.