 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F094337 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRRFPAPWTVEALDGGFKVIDANKQAIAYVYGHADKRDAETA |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.77 % |
| % of genes near scaffold ends (potentially truncated) | 73.58 % |
| % of genes from short scaffolds (< 2000 bps) | 86.79 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.811 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.189 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 22.86% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 5.66 |
| PF07311 | Dodecin | 2.83 |
| PF01068 | DNA_ligase_A_M | 1.89 |
| PF02735 | Ku | 1.89 |
| PF12244 | DUF3606 | 1.89 |
| PF14373 | Imm_superinfect | 0.94 |
| PF00893 | Multi_Drug_Res | 0.94 |
| PF01909 | NTP_transf_2 | 0.94 |
| PF00080 | Sod_Cu | 0.94 |
| PF03237 | Terminase_6N | 0.94 |
| PF13432 | TPR_16 | 0.94 |
| PF01391 | Collagen | 0.94 |
| PF07007 | LprI | 0.94 |
| PF06351 | Allene_ox_cyc | 0.94 |
| PF10544 | T5orf172 | 0.94 |
| PF05532 | CsbD | 0.94 |
| PF12200 | DUF3597 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 5.66 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 2.83 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.89 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.89 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.89 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.94 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.94 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.81 % |
| All Organisms | root | All Organisms | 30.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.77% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034419 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08807201 | 2228664022 | Soil | VRRFPRPWTVEAIGGGFKVVDANRQSIAYVYGYADKRDAENRQGES |
| F14TC_1000090931 | 3300000559 | Soil | MRRFPAPWTVEAIDAGFKVIDANGQALAYVYGYADMRDAGVANALSLD |
| JGI1027J11758_128717891 | 3300000789 | Soil | MRRFPPPWKVEALDGGFKVVDGNKQAVAYIYGNADPRD |
| JGI11615J12901_100835222 | 3300000953 | Soil | MRRFPAPWTVEAIDAGFKVIDANGKPLAYIYGYANTRAAKL |
| JGI10216J12902_1006501462 | 3300000956 | Soil | MRRFPAPWAVEAIDAGFKVKDSNGQALAYVYGHADKRDAETGANA* |
| Ga0062593_1000872072 | 3300004114 | Soil | MAHRRFPPPWRVEPIEGGFKVIDANKQSIAYVYGHADKHDAETS* |
| Ga0062593_1021716732 | 3300004114 | Soil | MRRFPRPWTVEAVDAGFKVIDANGQSLAYVYGHANKRDAETADGLTT* |
| Ga0062593_1022141352 | 3300004114 | Soil | MRRFPPPWTVEPLDAGYKVLDANGQVLAYVYGVDDLRDARIANS |
| Ga0062589_1007593011 | 3300004156 | Soil | MRRFPAPWTVEAIEAGLKVIDANKQGIAYVYGHSDKRDAETAKGL |
| Ga0063356_1002743425 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRRFPSPWTVEPLDAGYKVVDANGQALAYVYGIDDLRDARIAKSLTRDE |
| Ga0063356_1033356922 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRRFPPPWTVEPLDGGFKIVDANGQSLAYVYGLENARNAAIAKALTS* |
| Ga0063356_1044219762 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTERRFPAPWTVEPLDAGYKVVDANGQTLAYVYGIDDLRDARIAKSPR* |
| Ga0063356_1045749051 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTERRFPAPWTVEALDGGFKVLDSNGQSLAYVYGHADLRDA |
| Ga0062595_1025106242 | 3300004479 | Soil | TVETIEGGFKVVDANKQAVAYVYGHADKRDAEIAKSMTLDEGA* |
| Ga0068997_101613231 | 3300005204 | Natural And Restored Wetlands | MRRFPAAWTVEAIAGGFKIVDANKQSIAYVYGHADPRDAGIANSLSLDEAR |
| Ga0070690_1006304591 | 3300005330 | Switchgrass Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAETAKGLTLDEASTHSE |
| Ga0066388_1001227503 | 3300005332 | Tropical Forest Soil | MRRFPAPWTVEAIDAGFKVIDGNGQAVAYVYGHADKRDAGVANVSMKLDA* |
| Ga0066388_1061033053 | 3300005332 | Tropical Forest Soil | MRRFPAPWTVQPLDGGGFKIVDSNGQSIAYVYGHADLRDAQIANGLTTDEA |
| Ga0070668_1000930581 | 3300005347 | Switchgrass Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAETAKGLTLDEASTHSEQHREA |
| Ga0070659_1017666722 | 3300005366 | Corn Rhizosphere | MRRFPPPWTVEAIEAGFKVIDANKQSIAYVYGRADKRDAETAKSL |
| Ga0070709_114790021 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTRRKFPAPWRVEALDGGFKIVDANKQAIAYVYGHADPRDATIAK |
| Ga0070700_1014837041 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAETAKGLTLDEASTHSEQH |
| Ga0068853_1000916785 | 3300005539 | Corn Rhizosphere | VRRFPPPWIVEALDGGFKVIDSNGQSIAYVYGHADQRDAET |
| Ga0068853_1017077282 | 3300005539 | Corn Rhizosphere | RNNWSANPLSMAHRRFPPPWRVEPIEGGFKVIDANKQSIAYVYGHADKHDAETS* |
| Ga0070695_1014739192 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPWTVEAIEGGFKVVDANKQVVAYVYGCADKRDAEISKSDDT**S* |
| Ga0070665_1014944701 | 3300005548 | Switchgrass Rhizosphere | MRRFPPPWTVEAIEAGFKVIDSNGQAVAYVYGHADKRDAETAKGLTL |
| Ga0068855_1013784851 | 3300005563 | Corn Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKR |
| Ga0066903_1007249051 | 3300005764 | Tropical Forest Soil | MARRFPPPWTVERIAGGFRVLDANMQSLAYVYGHAERDVEIAKALTIDDARGASRPGS |
| Ga0066903_1030741862 | 3300005764 | Tropical Forest Soil | MRRFPLPWTVEPLDSGYKIVDGNKQTLAYVYGHADPRDA* |
| Ga0068862_1009331922 | 3300005844 | Switchgrass Rhizosphere | VRRFPAPWTVEAIEGGFKVVDANKQVVAYVYGCADKRDAEISKSDDT* |
| Ga0075023_1006076532 | 3300006041 | Watersheds | MRRFPAPWTVEAIDGGFKIVDANKQSIAYIYGHADPHRNRI* |
| Ga0075026_1005531212 | 3300006057 | Watersheds | AAVYSQPMRRFPPPWTLEALEGGFKIVDANGQSLAYVYGNADSHAAGITNALTLN* |
| Ga0075018_104198322 | 3300006172 | Watersheds | MARRFPAPWTVETLDGGFKIVDANKQAIAYVYGHADPRDAQ |
| Ga0070712_1014446162 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFPPPWTIEALDGGFKIMDANGQALAYVYGHANR |
| Ga0075428_1023449501 | 3300006844 | Populus Rhizosphere | MRRFPPPWTVEALDSGFKIVDANGQALAYVYGLDNARNAA |
| Ga0075421_1008357524 | 3300006845 | Populus Rhizosphere | MRRFPPPWTVEGIEAGFKVIDANGQALAYVYGYAGMRDAGVANALSLEARRIAS |
| Ga0075421_1010534832 | 3300006845 | Populus Rhizosphere | MRRFPAPWTVEAIDGGFKVVDANGQSLAYVYGYANPRDAGVAN |
| Ga0075425_1026735661 | 3300006854 | Populus Rhizosphere | VRRFPPPWRVEPIEGGFKVVDANKQAIAYLYGHADKRDAEIAKSMTLDEA |
| Ga0075419_101312995 | 3300006969 | Populus Rhizosphere | MRPRRFSAPWTVEALDGGFKVVDANGQGIAYVYGHADKRDAE |
| Ga0105250_101199271 | 3300009092 | Switchgrass Rhizosphere | MRRFPPPWTVQAIDAGFKVIDLNGQALAYVYGHADKRDAETAKG |
| Ga0105247_102877714 | 3300009101 | Switchgrass Rhizosphere | MRRFPAPWTVEAIDGGFQVVDANKKPLTIIHGHADPRDAGIANALTLDEATA* |
| Ga0105247_108758371 | 3300009101 | Switchgrass Rhizosphere | MRRFPAPWRVESIAGGFKIMDADKQSIAYVYGHADP |
| Ga0115026_117066681 | 3300009111 | Wetland | MRRFPPPWTVEPLDAGYKVVDANGQALAYVYGHAD |
| Ga0111538_109683804 | 3300009156 | Populus Rhizosphere | MRRFPAPWTVEAMDAGFKVIDANGQALAYVYGHADKRDAQTGNGLT |
| Ga0126377_110838131 | 3300010362 | Tropical Forest Soil | MKHRRFPPPWSVEAIKVIDSNGQSPAYGYGHADKRDA |
| Ga0126377_117134391 | 3300010362 | Tropical Forest Soil | MRRFPAPWTVETTDSGFKIVDANGQSLAYVYGLVRAIGWV |
| Ga0126379_104044571 | 3300010366 | Tropical Forest Soil | MRRFPAPWTVQPLDGGGFKIVDSNGQSIAYVYGHADL |
| Ga0134126_104713124 | 3300010396 | Terrestrial Soil | MRRFPAPWTVEAIDAGVKVIDANGQALDYVYGHADK |
| Ga0134126_122482632 | 3300010396 | Terrestrial Soil | MAERRFPPPWTVETLDGGFKNVDANKQAITYVYGHAD |
| Ga0134126_129014632 | 3300010396 | Terrestrial Soil | MRRFPAPWTVEEIAGGFKIVDANKQSLCYFYGHADPRDAGTA |
| Ga0134124_123239891 | 3300010397 | Terrestrial Soil | MRRFPAPWTVETIDAGFKVTDANGQALAYVYGYANPRDAGV |
| Ga0134124_123514621 | 3300010397 | Terrestrial Soil | MRRFPTPWTIEELEAGFKIVDGNGQTLAYVYGHVD |
| Ga0134121_123321142 | 3300010401 | Terrestrial Soil | MRRFPAPWTVEKIPGGFKVYDANGQSLAYVYGHADMRDAGVANAL |
| Ga0105246_105091741 | 3300011119 | Miscanthus Rhizosphere | VRRFPPPWIVEALDGGFKVIDSNGQSIAYVYGHADQRDAETAKGLSL |
| Ga0157304_10140843 | 3300012882 | Soil | MRRFPAPWTVEALDGGFKVIDANKQAIAYVYGHADKRDAETA |
| Ga0157304_10535641 | 3300012882 | Soil | MAHRRFPPPWRVEPIEGGFKVIDANGQSLAYVYGHADPRDAGIAKALTLE* |
| Ga0157301_100650822 | 3300012911 | Soil | RRFPPPWTVEAIEAGFKVIDANKQSIAYVYGRADKRDAETAAAAWRGRSPKHE* |
| Ga0137404_121303701 | 3300012929 | Vadose Zone Soil | MRRFPPPWTVEAVDGGFKVVDAKGQSLAYVYGHADPRDAEIAKAL |
| Ga0126375_115767841 | 3300012948 | Tropical Forest Soil | PWSVEAIEAGFKVIDSNGQSPAYVYGHADRRDAETAKENLRRC* |
| Ga0164300_100483642 | 3300012951 | Soil | MAERRFPPPWTVETLDGGFKTVDANKQAITYVYGHADQHDAQSPNR* |
| Ga0164303_102710782 | 3300012957 | Soil | VRRFPPPWRIEALDGGGFKVIDANGQSLAYVYGHADPRD |
| Ga0164299_115195902 | 3300012958 | Soil | MRRFPSPWTVEPLDAGYKVVDANGQVLAYVYGVDDLRDAGIANSLTLDE |
| Ga0164302_108820643 | 3300012961 | Soil | MAERRFPPPWTVEVIDGGFEIVDANKQAIAYVYGHA |
| Ga0164309_117748461 | 3300012984 | Soil | MRRFPPPWTVEALDGGFKIVDDNKQTIAYVYGHANPGDAAIAKAVSPSL |
| Ga0164308_107370083 | 3300012985 | Soil | MAERRFPPPWTVETLDGGFKTVDANKQAITYVYGHADKHDAQSPNR* |
| Ga0164305_119023402 | 3300012989 | Soil | MRRFPPPWTVEALEAGFKVVDANGQSLAYVYGYAHARDAAIAKALTLD |
| Ga0157373_100756835 | 3300013100 | Corn Rhizosphere | MRRFPAPWTVEALDGGYKVVDAQKQSIAYVYGCADKRDAD |
| Ga0157374_120917321 | 3300013296 | Miscanthus Rhizosphere | MRRFPAPCTVEAIDAGFKVIDANKQGIAYVYGHSDKRD |
| Ga0157372_127810072 | 3300013307 | Corn Rhizosphere | MGTVEPLDAGFKTVDANGQSLAYVYGIDDLRDARIAKSLTRD |
| Ga0163163_101045336 | 3300014325 | Switchgrass Rhizosphere | VRRFPPPWIVEALDGGFKVIDSNGQSIAYVYGHADQRDAETAKGLSLDE |
| Ga0157379_106007121 | 3300014968 | Switchgrass Rhizosphere | MRRFPAPWTVEAIDAGFKAVDANKQPLTHIYGHADPRDAGIANALTLDEATA* |
| Ga0132258_109497781 | 3300015371 | Arabidopsis Rhizosphere | MRRFPPPWTVEPLDAGYEVVDANGQVLAYVYGVDDLRDA |
| Ga0132258_131976852 | 3300015371 | Arabidopsis Rhizosphere | MRRFTAPWTVEAIDAGFKVVDANKQAIAYVYGHADKRES* |
| Ga0132256_1025488181 | 3300015372 | Arabidopsis Rhizosphere | MRRFPRPWTVEELDGGFKVLDANGPTLAYVYGHADVRDAQVANTLALDEA |
| Ga0132257_1031394792 | 3300015373 | Arabidopsis Rhizosphere | MKRFPAPWTVEAIDAGFKVIDSNGQSLAYVYGHADKPDAETAKVLLPRGIH* |
| Ga0132255_1002182214 | 3300015374 | Arabidopsis Rhizosphere | MRRFPAPWTVEAIEAGFKVLDANKQAITYVYSREYPSDALIARY* |
| Ga0132255_1014696131 | 3300015374 | Arabidopsis Rhizosphere | MKRFPTPWTVEAIDAGFKVIDANGQSLAYVYGHADTHDAQ |
| Ga0182035_102484073 | 3300016341 | Soil | MKHRRFPPPWSVEATEAGFKVINSNGQSPTFVYGHADKRDAEAAK |
| Ga0182034_103746733 | 3300016371 | Soil | MPRRFPPPWTVEALDGCSLSGFKVLDANRQSLAYVYWR |
| Ga0163161_113226721 | 3300017792 | Switchgrass Rhizosphere | MRRFPPPWTVEAIEAGFKIVDANKQSIAYVYGHADPRDAGTANA |
| Ga0187773_104546631 | 3300018064 | Tropical Peatland | MRRFPPPWTVEALDSGGLKVVDANNQSLAYVYGHADVRDAEIAKGVRLA |
| Ga0173481_103630061 | 3300019356 | Soil | MRRFPAPWTVEAIEGGFKVIDANGQAIAYVYGHADKRDAETAKGPDA |
| Ga0173482_102207633 | 3300019361 | Soil | MRRFPAPWTVEALDGGFKVIDANKQAIAYVYGHAD |
| Ga0207710_103716722 | 3300025900 | Switchgrass Rhizosphere | MRRFPPPWTVEAIDGGYKVVDSHGQSLAYVYGHADPHD |
| Ga0207671_101315411 | 3300025914 | Corn Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAET |
| Ga0207693_104341493 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFPAPWTIEVIDGGFKVIDSNGQSLAYVYGHADKRDAET |
| Ga0207644_103961041 | 3300025931 | Switchgrass Rhizosphere | MRRFPPPWTVQAIDAGFKVIDLNGQALAYVYGHADKRDAETAKGLTLDE |
| Ga0207690_100895431 | 3300025932 | Corn Rhizosphere | VRRFPPPWIVEALDGGFKVIDSNGQSIAYVYGHADQRDAE |
| Ga0207704_110144281 | 3300025938 | Miscanthus Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAETAKGLTLDEASTHSEQHRE |
| Ga0207711_120242451 | 3300025941 | Switchgrass Rhizosphere | MRRFPAPWTVEAIDAGFKVVDANKQPLTHIYGHADPRDA |
| Ga0207651_108312451 | 3300025960 | Switchgrass Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKRDAETAKGL |
| Ga0207640_109329682 | 3300025981 | Corn Rhizosphere | MDAASCYENGVRRFPAPWTVEAIEGGFKVVDANKQVVAYVYGCADKRDAEISKSDDT |
| Ga0207639_109807372 | 3300026041 | Corn Rhizosphere | MRRFPPPWTVQAIDAGFKVIDSNGQALAYVYGHAGKTR |
| Ga0170824_1159489782 | 3300031231 | Forest Soil | MAERRFPPPWTVEVIDGGFKIVDANKQAIAYVYGHADPRDAGIA |
| Ga0170820_141242932 | 3300031446 | Forest Soil | MAERRFPPPWNVEVIDGGFKIVDANKQAIAYVYGHADPRDAG |
| Ga0170818_1011998862 | 3300031474 | Forest Soil | MAERRFPPPWNVEVIDGGFKIVDANGQALAYVYGHADPRDAGNSQRADSR |
| Ga0306921_104622214 | 3300031912 | Soil | MKHRRFPPPWSVEATEAGFKVINSNGQSPTFVYGHADKRDAEAAKENLRR |
| Ga0214473_111648132 | 3300031949 | Soil | MRRFPPPWSVETLSGGFKVVDANNQALAYVYGHADKRDATTAKSLTLDE |
| Ga0306926_114032693 | 3300031954 | Soil | MKHRRFPPPWSVEATEAGFKVINSNGQSPTFVYGHADKRDAEAAKENL |
| Ga0306926_123087502 | 3300031954 | Soil | MKHRRFPPPWSVEATEAGFKVINSNGQSPTFVYGHADKRDAETAKENLRRC |
| Ga0318533_110882522 | 3300032059 | Soil | LNSANARRFPAPWTVEAIDAGFKVIDANGQSVAYVYGYADPRGAG |
| Ga0318505_103965411 | 3300032060 | Soil | MLSPRRFPPPWTVEELNDAGFVIRDSTGQKIAYVY |
| Ga0307470_102871571 | 3300032174 | Hardwood Forest Soil | MRRFPPPWTIEPLDAGYKVVDANGQVLAYVYGLDDSRDARIAKSLTR |
| Ga0307471_1039704792 | 3300032180 | Hardwood Forest Soil | MRRFPAPWTVEAIDGGFKIVDANGQGLAYVYGHADQRDAAIAK |
| Ga0307472_1015510122 | 3300032205 | Hardwood Forest Soil | MRRFPSPWTIEELDRGFKVLDANGQVLAYVYGHADPLPRR |
| Ga0373914_0109519_3_107 | 3300034419 | Sediment Slurry | MRRFPPPWTVEALDGGFKIVDASGQSLAYVYGHAD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |