| Basic Information | |
|---|---|
| Family ID | F094329 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VTAMNELSRADAAPWAARGSMFSQPGLARPVAWATPHDLDRLRASHT |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.15 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.40 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.660 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.943 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.00% β-sheet: 0.00% Coil/Unstructured: 64.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 3.77 |
| PF00296 | Bac_luciferase | 2.83 |
| PF00196 | GerE | 1.89 |
| PF00400 | WD40 | 1.89 |
| PF00975 | Thioesterase | 1.89 |
| PF00378 | ECH_1 | 1.89 |
| PF11774 | Lsr2 | 0.94 |
| PF00561 | Abhydrolase_1 | 0.94 |
| PF02897 | Peptidase_S9_N | 0.94 |
| PF16859 | TetR_C_11 | 0.94 |
| PF01610 | DDE_Tnp_ISL3 | 0.94 |
| PF13599 | Pentapeptide_4 | 0.94 |
| PF11716 | MDMPI_N | 0.94 |
| PF01872 | RibD_C | 0.94 |
| PF00069 | Pkinase | 0.94 |
| PF05231 | MASE1 | 0.94 |
| PF01266 | DAO | 0.94 |
| PF13669 | Glyoxalase_4 | 0.94 |
| PF02913 | FAD-oxidase_C | 0.94 |
| PF10604 | Polyketide_cyc2 | 0.94 |
| PF01370 | Epimerase | 0.94 |
| PF03466 | LysR_substrate | 0.94 |
| PF08922 | DUF1905 | 0.94 |
| PF00106 | adh_short | 0.94 |
| PF02604 | PhdYeFM_antitox | 0.94 |
| PF02627 | CMD | 0.94 |
| PF07728 | AAA_5 | 0.94 |
| PF12802 | MarR_2 | 0.94 |
| PF12680 | SnoaL_2 | 0.94 |
| PF00440 | TetR_N | 0.94 |
| PF01636 | APH | 0.94 |
| PF04978 | DUF664 | 0.94 |
| PF03853 | YjeF_N | 0.94 |
| PF00588 | SpoU_methylase | 0.94 |
| PF13302 | Acetyltransf_3 | 0.94 |
| PF04480 | DUF559 | 0.94 |
| PF02742 | Fe_dep_repr_C | 0.94 |
| PF08327 | AHSA1 | 0.94 |
| PF02668 | TauD | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.77 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.83 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.94 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.94 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.94 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.94 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.94 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.94 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.94 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.94 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.94 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.94 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.94 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.94 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.66 % |
| Unclassified | root | N/A | 44.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10026859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1449 | Open in IMG/M |
| 3300001686|C688J18823_10167447 | Not Available | 1500 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100467216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1139 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10079337 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300004152|Ga0062386_101105524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 658 | Open in IMG/M |
| 3300005435|Ga0070714_100870162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300005435|Ga0070714_101482795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 662 | Open in IMG/M |
| 3300005435|Ga0070714_102451915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300005437|Ga0070710_11125123 | Not Available | 577 | Open in IMG/M |
| 3300005471|Ga0070698_101987774 | Not Available | 535 | Open in IMG/M |
| 3300005471|Ga0070698_102084354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. KC345 | 521 | Open in IMG/M |
| 3300005535|Ga0070684_100993504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 787 | Open in IMG/M |
| 3300005563|Ga0068855_100541895 | Not Available | 1260 | Open in IMG/M |
| 3300005602|Ga0070762_10435046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 851 | Open in IMG/M |
| 3300005712|Ga0070764_10067623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1859 | Open in IMG/M |
| 3300006028|Ga0070717_11477993 | Not Available | 617 | Open in IMG/M |
| 3300006028|Ga0070717_12113976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300006172|Ga0075018_10578641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300006175|Ga0070712_101449582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300006175|Ga0070712_101745010 | Not Available | 545 | Open in IMG/M |
| 3300006176|Ga0070765_101001395 | Not Available | 790 | Open in IMG/M |
| 3300006176|Ga0070765_102030017 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006914|Ga0075436_100917062 | Not Available | 656 | Open in IMG/M |
| 3300006954|Ga0079219_10045441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1855 | Open in IMG/M |
| 3300009101|Ga0105247_11053007 | Not Available | 639 | Open in IMG/M |
| 3300009522|Ga0116218_1255334 | Not Available | 787 | Open in IMG/M |
| 3300009824|Ga0116219_10146103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1370 | Open in IMG/M |
| 3300010046|Ga0126384_10262181 | Not Available | 1403 | Open in IMG/M |
| 3300010358|Ga0126370_11781139 | Not Available | 595 | Open in IMG/M |
| 3300010376|Ga0126381_103804840 | Not Available | 589 | Open in IMG/M |
| 3300010398|Ga0126383_10155719 | Not Available | 2138 | Open in IMG/M |
| 3300010876|Ga0126361_10724606 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012209|Ga0137379_11094507 | Not Available | 703 | Open in IMG/M |
| 3300012923|Ga0137359_11632452 | Not Available | 532 | Open in IMG/M |
| 3300014657|Ga0181522_10116017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
| 3300014969|Ga0157376_11528568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 701 | Open in IMG/M |
| 3300015242|Ga0137412_10485686 | Not Available | 947 | Open in IMG/M |
| 3300018033|Ga0187867_10187865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
| 3300018034|Ga0187863_10433654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300018060|Ga0187765_10411195 | Not Available | 838 | Open in IMG/M |
| 3300018085|Ga0187772_10368150 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300020002|Ga0193730_1178110 | Not Available | 538 | Open in IMG/M |
| 3300020581|Ga0210399_11195620 | Not Available | 604 | Open in IMG/M |
| 3300020582|Ga0210395_10421840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
| 3300021171|Ga0210405_10090885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2407 | Open in IMG/M |
| 3300021171|Ga0210405_10910571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300021178|Ga0210408_10154601 | Not Available | 1817 | Open in IMG/M |
| 3300021403|Ga0210397_11151077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300021407|Ga0210383_11333495 | Not Available | 599 | Open in IMG/M |
| 3300021407|Ga0210383_11356604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300021433|Ga0210391_10164536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 1747 | Open in IMG/M |
| 3300021477|Ga0210398_11516444 | Not Available | 521 | Open in IMG/M |
| 3300021478|Ga0210402_11351774 | Not Available | 640 | Open in IMG/M |
| 3300021478|Ga0210402_11603225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 578 | Open in IMG/M |
| 3300021560|Ga0126371_12420980 | Not Available | 635 | Open in IMG/M |
| 3300021560|Ga0126371_13323617 | Not Available | 543 | Open in IMG/M |
| 3300024220|Ga0224568_1029704 | Not Available | 575 | Open in IMG/M |
| 3300025906|Ga0207699_10184501 | Not Available | 1404 | Open in IMG/M |
| 3300025917|Ga0207660_11393051 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025941|Ga0207711_11508527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea typhae | 615 | Open in IMG/M |
| 3300025961|Ga0207712_11467677 | Not Available | 611 | Open in IMG/M |
| 3300026116|Ga0207674_10381411 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300027158|Ga0208725_1033730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 801 | Open in IMG/M |
| 3300027371|Ga0209418_1028088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 965 | Open in IMG/M |
| 3300027545|Ga0209008_1065184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300027575|Ga0209525_1157527 | Not Available | 516 | Open in IMG/M |
| 3300027817|Ga0209112_10086859 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300027884|Ga0209275_10230200 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300027895|Ga0209624_10324877 | Not Available | 1025 | Open in IMG/M |
| 3300028773|Ga0302234_10438627 | Not Available | 558 | Open in IMG/M |
| 3300028784|Ga0307282_10098410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 1355 | Open in IMG/M |
| 3300028791|Ga0307290_10380998 | Not Available | 516 | Open in IMG/M |
| 3300028806|Ga0302221_10453953 | Not Available | 559 | Open in IMG/M |
| 3300028806|Ga0302221_10503235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300028808|Ga0302228_10128936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300028828|Ga0307312_10041290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2725 | Open in IMG/M |
| 3300028877|Ga0302235_10343278 | Not Available | 643 | Open in IMG/M |
| 3300028879|Ga0302229_10225106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 853 | Open in IMG/M |
| 3300029636|Ga0222749_10624178 | Not Available | 589 | Open in IMG/M |
| 3300029911|Ga0311361_10383214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
| 3300029943|Ga0311340_10474099 | Not Available | 1126 | Open in IMG/M |
| 3300029999|Ga0311339_10839895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia albiluteola | 879 | Open in IMG/M |
| 3300029999|Ga0311339_10987822 | Not Available | 790 | Open in IMG/M |
| 3300030058|Ga0302179_10391245 | Not Available | 612 | Open in IMG/M |
| 3300030490|Ga0302184_10036980 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300030520|Ga0311372_12376961 | Not Available | 601 | Open in IMG/M |
| 3300030580|Ga0311355_11762479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia albiluteola | 526 | Open in IMG/M |
| 3300030760|Ga0265762_1067335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rubrisoli | 746 | Open in IMG/M |
| 3300031234|Ga0302325_11161389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300031545|Ga0318541_10856152 | Not Available | 507 | Open in IMG/M |
| 3300031640|Ga0318555_10622948 | Not Available | 584 | Open in IMG/M |
| 3300031708|Ga0310686_105238480 | Not Available | 814 | Open in IMG/M |
| 3300031718|Ga0307474_10875895 | Not Available | 711 | Open in IMG/M |
| 3300031764|Ga0318535_10111029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
| 3300031910|Ga0306923_12276580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola pocheonensis | 541 | Open in IMG/M |
| 3300032055|Ga0318575_10574051 | Not Available | 572 | Open in IMG/M |
| 3300032892|Ga0335081_10629757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 1317 | Open in IMG/M |
| 3300032895|Ga0335074_10371741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium thailandense | 1572 | Open in IMG/M |
| 3300032896|Ga0335075_10033586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7375 | Open in IMG/M |
| 3300032896|Ga0335075_10406291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1445 | Open in IMG/M |
| 3300032896|Ga0335075_10969504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300032898|Ga0335072_10118335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3337 | Open in IMG/M |
| 3300032954|Ga0335083_10278589 | Not Available | 1480 | Open in IMG/M |
| 3300032955|Ga0335076_10856573 | Not Available | 790 | Open in IMG/M |
| 3300033134|Ga0335073_11375362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
| 3300034163|Ga0370515_0011031 | All Organisms → cellular organisms → Bacteria | 4279 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.04% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_100268591 | 3300001546 | Forest Soil | MNELSRTAAAPWAARGPVFSQPGLARPVAWATPHDLDRQRASHAR |
| C688J18823_101674471 | 3300001686 | Soil | MKKLSRSDAVPWAARGPAFSQAGLARPVAWTAPHDLDRLRAS |
| JGIcombinedJ26739_1004672161 | 3300002245 | Forest Soil | MDELSPAAAAPWAARGSMFSQPGLARPVAWATPRDLD |
| JGIcombinedJ51221_100793373 | 3300003505 | Forest Soil | MDELPRTAAGPWAARGPVFSQPGLARPVAWTAPHDLDRLRASQTRGRP |
| Ga0062386_1011055241 | 3300004152 | Bog Forest Soil | VTSMNELSRTAAPRAARSPVFSQPGLARPVAWATPHDLDRMRARPGRGQLGKPLV |
| Ga0070714_1008701621 | 3300005435 | Agricultural Soil | MNELSRAAVAPWARRGSMFSQAGLARPVDWASPRDLDRLRASRA |
| Ga0070714_1014827951 | 3300005435 | Agricultural Soil | MNELSRTAAPWAARGPVFSQPGLARPVAWATPQDLDRMRARPARGQRGKP |
| Ga0070714_1024519152 | 3300005435 | Agricultural Soil | VTAMNELPRAAVAPWARRGSMFSQAGLARPVDWASPRDLDRLRASRA |
| Ga0070710_111251232 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAMNELSRADAAPWTARGSMFSQPGLARPVAWATPHDLDQLRASHARGQPGKPL |
| Ga0070698_1019877741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEPSPATAAPWAARGSLFSQPGLARPVTGATPHDLDRLRASHARGR |
| Ga0070698_1020843541 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAMNELSRADAAPWAARGSRFSQPGLARPVAWATPHDLDRLRASH |
| Ga0070684_1009935043 | 3300005535 | Corn Rhizosphere | VTAMNDLSRAATAPWAARRSQMFSQAGLARPVTRATPQDLDRLRASRA |
| Ga0068855_1005418955 | 3300005563 | Corn Rhizosphere | MNELSRADAAPSAARGSMFSQPGLARPVAWATPHDLDRLRA |
| Ga0070762_104350461 | 3300005602 | Soil | VSAMDELPRADAALGAARGSMFSQHGLAGPVAGATPQDLDRLR |
| Ga0070764_100676232 | 3300005712 | Soil | MNELSRTAAAPWAARGPVFSQPGLARPTAWATSQDPDRLRAGHARGQLGKPLV |
| Ga0070717_114779933 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSMDDLSRAAAAPWAARGPVFSRPGLARPVAWAAPDDLDRLRARQA |
| Ga0070717_121139762 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNELSRAAVAPWARRGSMFSQAGLARPVDWASPRDLDRLRASRARERLDRPLVP |
| Ga0075018_105786412 | 3300006172 | Watersheds | VIAMNELSRTAVPWAARGPVFSQPGLARPVAWATPDDLDRLRASHARGQLGKPLVP |
| Ga0070712_1014495822 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNELSRAAVAPWARRGSMFSQAGLARPVDWASPRDLDRLRASRARERLD |
| Ga0070712_1017450102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELSRADAALVAARGSMFSQPGLAGPVAGATPQDLDRLRA |
| Ga0070765_1010013952 | 3300006176 | Soil | VSAMEDLSRADAALGAARGSMYSQAGLAGPVAGATPEDVDRLRARHASGRR |
| Ga0070765_1020300171 | 3300006176 | Soil | VTSMNEIPRTAAERWARGPMFSQPGLARPVARAAPHDLDRLRASHARGQL |
| Ga0075436_1009170621 | 3300006914 | Populus Rhizosphere | MNDLSRAAAAPWAARGPVFSRPGLARPVAWAAPDDLDR |
| Ga0079219_100454413 | 3300006954 | Agricultural Soil | VTAMKELSRTDAVPWASRGPIFSQAGLARPVDWSTPDDLDRLRASHARGRLG |
| Ga0105247_110530071 | 3300009101 | Switchgrass Rhizosphere | VTAMDERSSADAAPWAGRGSMFSQAGLARPVDWATPQDLDRLRASHSRRRPGRA |
| Ga0116218_12553341 | 3300009522 | Peatlands Soil | VTAMDELSPATAAPWAARGSMFSQPGLARPVAWAPRM |
| Ga0116219_101461032 | 3300009824 | Peatlands Soil | MNELSRTAAPWAARGPVFSQPGLASPVAWATPHDLDRLRASHARGHLG |
| Ga0126384_102621811 | 3300010046 | Tropical Forest Soil | VTAMKKMSRTDAAPWAARGPMFSQAGLARPVDWATSRDLD |
| Ga0126370_117811391 | 3300010358 | Tropical Forest Soil | VTSMNDLSRAAAAPWAARGPAFSRPGLARPVAWAAPDDLDRLRARQARGALGKPL |
| Ga0126381_1038048401 | 3300010376 | Tropical Forest Soil | MNELSRAAAAPWAARGPAFSQPGLARPAAWATPHDLDRLRASHARGRL |
| Ga0126383_101557193 | 3300010398 | Tropical Forest Soil | MDERSRADAVPWAGRGSVFSQAGLAQPVAWATPHDLDRLRASHRR |
| Ga0126361_107246062 | 3300010876 | Boreal Forest Soil | MDQLSRADAAPWAARGSLFSQPGLARPVAWATPHDLDRLRASHARGRLGKSL |
| Ga0137379_110945071 | 3300012209 | Vadose Zone Soil | VTAMDEPSPAAAAPWAARGSMFSQPGLARPVAWATPRD |
| Ga0137359_116324521 | 3300012923 | Vadose Zone Soil | MNELSRADAAPWAARGSMFSQPGLARPVAWDTPHDLDRLRATHARGR |
| Ga0181522_101160173 | 3300014657 | Bog | VTSMNELSRPAAAPWAARGPMFSQPGLARPVGWATPPDMDRLRASHAR |
| Ga0157376_115285682 | 3300014969 | Miscanthus Rhizosphere | VTAMDESPPAGAPPWAARGSMFSQPGLARPVAWAT |
| Ga0137412_104856861 | 3300015242 | Vadose Zone Soil | MNDLSRAAAPWAAGGPVFSRPGLARPVAWAAPDDLDRQRARQARGALGKPLVPA |
| Ga0187867_101878654 | 3300018033 | Peatland | VSAMDELSRADAAPWAERGSTFSQPGLAGPVAWATP |
| Ga0187863_104336541 | 3300018034 | Peatland | MDELSRAAGAPWAARGSMFSQPGLARPVAWAAPHDLDR |
| Ga0187765_104111951 | 3300018060 | Tropical Peatland | VTAMDKRSRARAAPWARRGSVFSQAGLARPADWATPPDLDRLRASRGRGR |
| Ga0187772_103681501 | 3300018085 | Tropical Peatland | MDEPTRAATAPWAGRGAMFSQAGLARPVAWASPQDLDR |
| Ga0193730_11781101 | 3300020002 | Soil | VTAMNELSRADAAPWAARGSMFSQPGLARPVAWATPHDLDRLRASHT |
| Ga0210399_111956201 | 3300020581 | Soil | VTAMNELSRAGAAPWAERGSVFSQAGLARPVAWATPDDLDRLRASHGRRRL |
| Ga0210395_104218402 | 3300020582 | Soil | VTAMNELSRTAAAPWAARGPVFSQPGLARPVAWAAPHDLDRLRASHAGGQLGKPL |
| Ga0210405_100908851 | 3300021171 | Soil | MNDLSRTAAAPWAARGPAFSQPGLARPVAWATPHDLDR |
| Ga0210405_109105711 | 3300021171 | Soil | MNELSRTAAAPWAARGPVFSQPGLARPVAWATPHDLDRLRASHARGQLGKPLVPT |
| Ga0210408_101546011 | 3300021178 | Soil | MDELSPAAAAPWAERGSMFSQPGLARPVAWATPRDLDRLRASHARGRMG |
| Ga0210397_111510771 | 3300021403 | Soil | VTAMDRRSRAEAAPWAGRGAMFSQAGLARPVPWATPRDL |
| Ga0210383_113334951 | 3300021407 | Soil | VTSMNDLSRAAAAPWAARGPMFSRPGLARPVAWAAPDDLDRQRASQARGALGKP |
| Ga0210383_113566041 | 3300021407 | Soil | VTAMDRRSRAEAAPWAGRGAMFSQAGLARPVPWATPRDLDRLR |
| Ga0210391_101645364 | 3300021433 | Soil | VIAMNELSRTAMPWAARGPVFSQPGLARPVAWATPDDRDRLRASHAGGQLAKPL |
| Ga0210398_115164441 | 3300021477 | Soil | VAAMNELSGTDATPWAGRGSVFSQAGLARPVAWAAPQDLDRLRASHAR |
| Ga0210402_113517741 | 3300021478 | Soil | MNDLSRAAAAPWAARGPMFSRPGLARPVAWAAPHDLDRLRASQERGALGKPL |
| Ga0210402_116032251 | 3300021478 | Soil | VTSMNELSRTAAPWAARGPVFSQPGLARPAAWAAPHDLDRMRARPARGQLGKP |
| Ga0126371_124209801 | 3300021560 | Tropical Forest Soil | MNERSRADAAPWAGRGSVFSQAGLAQPEAWATPHD |
| Ga0126371_133236171 | 3300021560 | Tropical Forest Soil | VTAMDERSRAGAAPWAGRGSVFSQAGLAQPVAWATPHDLDRLRA |
| Ga0224568_10297042 | 3300024220 | Plant Litter | MNELSRTAVPWAARGPAFSQPGLARPVAWATPDDLDRLRASHPGGQLGKPL |
| Ga0207699_101845012 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSMNDLSRAAAPRAARGPMFSRPGLARPVAWAAPHDLDRLRASARGALG |
| Ga0207660_113930512 | 3300025917 | Corn Rhizosphere | MDERSRADAPPWAGRGSVFSQAGLARPVAWDTPHDLDRLRASHPRRRPGRPLVPT |
| Ga0207711_115085271 | 3300025941 | Switchgrass Rhizosphere | MNKLSRADAAPWAARGSMFSQAGLARPVDWATPRDLDRLR |
| Ga0207712_114676772 | 3300025961 | Switchgrass Rhizosphere | MNELSRADAAPWAARGSMFSQPGLARPVAWATPHDLDRLRASHARGRLGKPLV |
| Ga0207674_103814111 | 3300026116 | Corn Rhizosphere | VTAMDERSSADAAPWAGRGSMFSQAGLARPVDWATPQDLDRLRASHSRRRPGR |
| Ga0208725_10337301 | 3300027158 | Forest Soil | VTAMNERPRPVGPPWAQRGSMFSQPGLARPVDWAS |
| Ga0209418_10280882 | 3300027371 | Forest Soil | MNELSRADAAPWAARGSMFSQAGLARPVDWATPRDLDRLRAS |
| Ga0209008_10651842 | 3300027545 | Forest Soil | MNELSRTAAPWAARGPAFSQPGLARPVAWATPHDLDRLRAG |
| Ga0209525_11575271 | 3300027575 | Forest Soil | VTAMNELSRAGAAPWPGRGSAFSQAGLARPVAWATAQDLDRLRASHARSRLGKPL |
| Ga0209112_100868591 | 3300027817 | Forest Soil | MSELSRTAAAPWAARGAVFSQPGLARPVAGAAPHDLGRLRAGHGR |
| Ga0209275_102302002 | 3300027884 | Soil | MKELPRTGTAPWAARGPVFSQPGLARPVAWTAPHDLDRLRASQARGRP |
| Ga0209624_103248771 | 3300027895 | Forest Soil | MDELSRAGAAPWAGRGSVFSQAGLARPVAWATPRD |
| Ga0302234_104386271 | 3300028773 | Palsa | VIAMNKLSRTAAAPWAARGPAFSQPGLARPVAWATPDDRARLRASHARGQLGEP |
| Ga0307282_100984101 | 3300028784 | Soil | VTAMDERSRADAAPWAGRGSVFSQVGLARPVAWATPDDLDRLRASHGR |
| Ga0307290_103809982 | 3300028791 | Soil | VTAMDERSRADAAPWAGRGSVFSQVGLARPVAWATPDD |
| Ga0302221_104539532 | 3300028806 | Palsa | VTAMDELSRAADAPWAARGPVFSQPGLARPVAWATP |
| Ga0302221_105032351 | 3300028806 | Palsa | MDELSRADAAPWAARGSMFSQPGLARPVAWATPHDLDRLRASHARGRLGKP |
| Ga0302228_101289361 | 3300028808 | Palsa | MNKLSRTAAAPWAARGPAFSQPGLARPVAWATPDDRAR |
| Ga0307312_100412905 | 3300028828 | Soil | VTAMNELSRADAAPWAARGSMFSQPGLARPVAWATPH |
| Ga0302235_103432782 | 3300028877 | Palsa | VTAMDELSRAVAAPWAARGSMFSQPGLARPVAWATPHDLDRQRASHTHGQLGE |
| Ga0302229_102251061 | 3300028879 | Palsa | VTAMDELPRAAAAPWAARGPVFSQPGLARPVAWATPHDLDRLRASHARGQRGE |
| Ga0222749_106241781 | 3300029636 | Soil | VTAMDELSPAAAAPWATRGSMFSQPGLARPVAWATPHDLDRLRA |
| Ga0311361_103832141 | 3300029911 | Bog | MDELSRADAAPWAARGSMFSQPGLARPVAWATPHDLDRLRASHARGRLGKPLV |
| Ga0311340_104740993 | 3300029943 | Palsa | MDELSRADAAPWAARGSMFSQPGLAGPVAWATPQDLDRLRA |
| Ga0311339_108398951 | 3300029999 | Palsa | VTAMDELSRAAAAPWAARGSMFSQPGLARPVAWAAPHDLDRL |
| Ga0311339_109878222 | 3300029999 | Palsa | MNELPRTAAAPWAARGPVFSQPGLARPVTWAAPHDLDR |
| Ga0302179_103912451 | 3300030058 | Palsa | VTAMDELSRAADAPWAARGPVFSQPGLARPVAWATPHDLDRLRASHA |
| Ga0302184_100369804 | 3300030490 | Palsa | VTSMDELSRAAGAPWAARGPMFSQAGLARPVAWATPHDLDRLRASHA |
| Ga0311372_123769612 | 3300030520 | Palsa | VTAMDELPRAAAAPWAARGPVFSQPGLARPVAWATPHDLDRLRGSHARGRLGK |
| Ga0311355_117624791 | 3300030580 | Palsa | VTSMDELSRAAGAPWAARGPMFSQAGLARPVAWATPHDLDRLRASH |
| Ga0265762_10673352 | 3300030760 | Soil | MNELSRTAAAPWAARSPVFSRPGLARPVAWAAPHDL |
| Ga0302325_111613892 | 3300031234 | Palsa | VAAMDELSRAVGAPWAARGSMFSQPGLARPVAWATPHDLDRLRA |
| Ga0318541_108561521 | 3300031545 | Soil | MDELSRAATAPWAARGAMFSQAGLARPVAWASPQDLNRLRARHRRGRLGRPLV |
| Ga0318555_106229481 | 3300031640 | Soil | MDEPSRAATAPWAARGAMFSQAGLARPVAWASPQDLNRLRARHRRGRLGR |
| Ga0310686_1052384801 | 3300031708 | Soil | VTGMSELSRTAAAPWAARGPVFSQPGLARPVAWAAPRDL |
| Ga0307474_108758951 | 3300031718 | Hardwood Forest Soil | MDDLSRAGVAPWAVRGPMFSQAGLARPAVSAAPRD |
| Ga0318535_101110291 | 3300031764 | Soil | MDEPSRAATAPWAARGAMFSQAGLARPVAWASPQDLNRLRARH |
| Ga0306923_122765801 | 3300031910 | Soil | MDELSRAATAPWAERGPVFSQPGLARPVAWTAPHDLDRLRAGHGRGRLGKP |
| Ga0318575_105740511 | 3300032055 | Soil | MDELSRAATSPWAERGPVFSQPGLARPVAWTAPHDLDRLRAGHGRGRLGKPLV |
| Ga0335081_106297571 | 3300032892 | Soil | VTAMDKRSRAGAAPWAGRGSVFSQAGLARPVAWAT |
| Ga0335074_103717411 | 3300032895 | Soil | MNELSRTAAAPWARRGPVFSQAGLARPVDWATPHDLDRLRTRQARSQ |
| Ga0335075_100335869 | 3300032896 | Soil | VASMNERLRAGAAPWAGRGSVFSQAGLARPVARASPAD |
| Ga0335075_104062914 | 3300032896 | Soil | VTSMNELSRTAAVPWAARDPVFSQPGLARPVAWAT |
| Ga0335075_109695043 | 3300032896 | Soil | MSELSRTPAAPWARRGPVFSQAGLARPVDWATPEDLNR |
| Ga0335072_101183351 | 3300032898 | Soil | VTSMNELSRTPAAPWAARGPVFCQAGLARPVDWATPDD |
| Ga0335083_102785891 | 3300032954 | Soil | VTAMNELSRTAAAPWAARGLAFSQPGLARPAAWATPHDLDRQRTSHARGRLGKPLV |
| Ga0335076_108565732 | 3300032955 | Soil | VTAMNELSRPAAAPWAARGPAFSQPGLARPAAWAAPHDLDRLRAS |
| Ga0335073_113753621 | 3300033134 | Soil | VTAMNEPSRAGAAPWARRGSVFSEAGLARPVAWATPRDLDR |
| Ga0370515_0011031_1_165 | 3300034163 | Untreated Peat Soil | MNELSRTAVPWAPRGPAFSQPGLARPVAWATPHDLDRLRASHARGKPDKPLVPTS |
| ⦗Top⦘ |